close all open/close all

CDS information : Tauto_00100


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction43,826 / 26,694 / - [in whole cluster]
43,826 / 26,694 / - [in contig]
Locationcomplement(26694..43826) [in whole cluster]
complement(26694..43826) [in contig]
TypeCDS
Length17,133 bp (5,710 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)ttmI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionPKS/NRPS Module

7 malonyl-CoA
8 malonyl-CoA
9 methylmalonyl-CoA
KS35..411
AT572..883
DH929..1094
ER1391..1697
KR1707..1887
ACP1981..2055
KS2078..2451
AT2611..2902
kr3221..3401
ACP3505..3575
KS3598..3973
AT4127..4443
DH4490..4658
ER4970..5272
KR5282..5462
ACP5559..5633

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MTASVDRLTEALRASLLANKRLKQENKALTEAAHDPVVLVGMACRFPGGVRGPEDLWRLV
ANGAEGIGPFPLDRSWDLDALLGTDGPGSGISATGEGGFLEGPGDFDAAFFRMSPREALA
TDPQQRLLLEVSWEALERAGIDPSSLAGSRTGVFAGVYQSGYNELLSHADEQLRGHQITG
GAPSVISGRVSYTLGLEGPAVSVDTGCSSSLVSMHLAAQALRAGECTLALAGGVAVMAAS
DAFVGFTAQGGLATDGRCKSFADAADGTGWSEGVGIVVMERLSAARRHGHEVLAVFRSSA
INQDGASNGLTAPNGPSQQRVIRQALTAAGLSASDIDAVEAHGTGTRLGDPIEAQALLAT
YGQDRPEGRPLWLGSLKSNIGHTQAAAGVGGVIKMVMALRHAVLPKTLHVDAPTTQVDWA
QGDVRLLTESRPWPESGHPRRVGVSSFGVSGTNAHVILEAPTDAGSPAAAPSGPGVFGAA
GMVPWILSGKTEDAVRAQAAKLLAHLEAEPAPGPVDVGWSLVTTRAMFEHRAVLLGTERD
ELLTGLRAVASGESAPGTTLGTAAEDNQLGVLFTGQGAQRVGMARGLYGESPVFAAALDE
VCAELDPLLDRPLCEAMWGEDAELINETGWAQPALFAVEAALFEVLRAFGTTPDYLLGHS
IGEVTAAYIAGVWSLSDACRVVAARARLMQALPSGGAMAAISLPEAEVVELLPESVSVAA
VNTADSVVISGPREAVDGVVEVVSGQGHRVSRLRVSHAFHSSLMEPMLAEFQQVLESVSF
APPRIPVVSNLTGVRATDEELCSPEYWTRQVRSAVRFADGVRWLGEQGVTALVELGPDGV
LSGLARQSCPPETVVVPLLRREQGDVPTLASALAHLCAQGVEVDWTTLFAGRDVTRVPLP
TYAFQHQRYWHTSSGSGDVSAAGLTAAEHPLLGAMLPLPQTDGLVFTSRLSVRTHPWFAD
HMVRGAVVFPGAGLVELVIRAGDSAGCDRLDELVLETPLVLPAQGGAQLQVVVGEDDAHR
RAVAVYARPDGEETWTRHATGTVSSAATGPADDAPFDVLGRQWPPAGAAPLDTERFYERL
GGGEFAYGPAFRGLREAWRDGDRILAEIELPEPGRGSAESFGIHPALLDAALHAMVFADL
ESAGVGWLPFSFADVVLRASGASRLRVALTRTGSDEVTIAVADDTGAPVLSVGSLAVRPL
AAGSLAAGDVGTLLKPEWTAITGTVAAVDEWLVADPADVTAVAADAEPQAVVLAVSGDPE
AVVASTHELTGHVLRQLQQWLSDDRFASIPLVVATSGAIAAEREPVRDLAAAAVWGLVRS
AQTEHPGRFVLLDADCAVDADVLGQVLAADEPQLAVRKGQLLAARLTRTGPADELAAPRD
RPWRLESTEKGMLENLALLPCPEAVEPLESGQVRIRVHAAGLNFRDVLNALGMYPGKAGP
LGGEAAGVVTGTGTGVTGLRVGDRVMGLVPGGFGRVAVTDHRLLTVVPDGWSFTTAASVP
IVFLTAYYGLADLAGLRTGESVLVHAGAGGVGLAAIQVARHLGAEVYTTASEGKWDVLRE
WGVRPERLASSRDLGFREAFRTATAGRGVDVVLNSLAGEFVDASLDVLASGGRFVEMGKT
DVRPAESLTDRYPGLSYHAFDLSDAGAERVQRMLRELVDLFEAGVLRPLPVTTWDVRQAP
EAFRFMSRARHVGKLVLTVPHEPDAAGTVVITGGTGALGAVVARHLVGEHGVRHLMLLSR
RGPDAPGAAELVAELARHGAEVTVAACDVTDRRALADALASVTPEHPLTGVVHTAGVVDD
GVLGSLSQDQVDRVLSPKVDAAWHLHELTRDLDLPLFLVFSSLSGVLGSGGQANYAAGNS
FLDALMQRRRDLGLPGLSMAWGPWTTEIGMAGALSRTDLQRLARSAMPPLTTEQGMDLFD
RAARSAQPVLGLARLNLPALRKQQDLPVWRTLTGGRRRAANRRSTGRGLGGQLASMSTAD
RERALAELVRESAATVLGHSSGAGIDPARLFSDLGFDSLTAVELRNLIQARTGIALVAGV
VFDHPTVTRLAGHLADRFGDSRTTGPTAVPEPVSGAADPIVLVGMACRLPGGVTGPDDLW
RLVSEAGDGIGPFPVDRGWDLDELVSPDGTGMSATGEGGFLTGADEFDAPFFRISPREAV
ATDPQQRLLLEVSWEALEQAGILPETLAGSRTGVFTGAYQMGYGELVARSDDQLRGHQIT
GGATSVISGRVAYTLGLEGPAVSVDTACSSSLVAMHLAAQALRAGECSLALAGGVTVMAT
PEAFVGFTMQGGLSADGRCRSFAETANGTGWSEGVGVVVMERLSDARRNGHEVLAVFRSS
AVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSASDVDVVEAHGTGTRLGDPIEADALLA
TYGQDRPEDRPLWLGSLKSNIGHAQAAAGVAGVIKMVLALRHGVLPKTLHAERPTTQVDW
ARGEVRLLTDAVPWQENGHPRRAGVSSFGVSGTNAHVILEAPAETGAPHEAAPGTGAVGA
GGVVPWVLSGRSDEAVRAQAARLLEYVEGAPSVRPVDVGWSLVTSRTAFDHRAVVVGGDR
EELISGMRAVAGGAPGVVRGTARCGHRLGVLFTGQGAQRVGMARGLYGESPVFAAALDEV
CAELDPLLDRPLREVMWGEDAELINETGWAQPALFAVEAALFEVLRAFGTTPDYLLGHSI
GEVTAAYVAGVWSLADACRVVAARARLMQALPSGGAMAAVGMSEAEIAGLLPETVSVAAV
NTADSVVVSGPQADVDQVLSLASECDARVSRLRVSHAFHSSLMDPMLDEFRRVLESVRFE
PPRIPLVSNVTGVRASDEELCSPEYWVRQVRSAVRFADGVRWLGEQGVTTMVELGPDGAL
SGLAQDSSAVAAVPMLRRQKSGGQCDSGLVLSAIGQLSAHGVAVDWTTAFAGRGAVRVPL
PTYAFQHQRYWPDTVRAAPEPSEDRADRRFWASVEHQDVQGLATTLGLDGGVVAPVVPAL
ASWRARRHEQSLVDGWRYREVWKRLAVAGAPTTGQWLVVVPEGARDDAWAAEVAHALGAS
TLVLDHSGAELTERLKEAGESAAGVTGVVSLAAALEPGITAGLAATTSLLRAVLDSGLAA
RIWVVTRGAMSVGPHDPVIAPAQGGVWGLGRVAALELPALWGGLADLPEVLDPRSARWLA
AALPGTTGEDQIVVRPAGVFGRRLVHAPVAGSGDPSWTTSGTALVTGGTGELGAYAARWL
VERGAEHVVLVSRRGLDAEGADALRLELEVAGARVTVAACDVTDRQALADVMAGIPEEWP
LRTVVHAAGVVSEDRALTSATADDLDQQVRAKVHGAHNLDEFTRELELDAFVLFCSGAGV
WGSGGQAGFAAANAYLDSLARHRRAAGRTATAIAWGSWDQVGALSDPGAAQREQLRLLGV
VPMRPELAVAALQRAVHDDETAIVVADLDWARFAPVFTAARSSALLSGLPEAEAALTATR
DDTAISGELRDRLAGLSEADRREVLLGLVRDSSAAVLGHGSSAEIESDQPFSELGFDSLT
AVELRNRLQAATGVALPASLVFDYPTANRLVDHLAGRFGVTESAQPSVVPASVPVADDPI
VLVGMACRFPGGVSSPDALWRLVADGADGITPFPVDRGWDLDTLVGTDGPGSGTSATAEG
GFLDEVADFDAAFFRISPREALATDPQQRLLLEVSWEALEQAGIDPTSLAGSSTGVFAGA
YQSGYLELVSRADEQLRGHALTGGAGSVISGRIAYTLGLEGPAVSVDTACSSSLVAMHLA
AQALRAGECSLALAGGVTVMAAADTFVGFSIQGGLAVDGRCKSFSDDADGTGWSEGVGVV
VLERMSDARRNGHEVLAVLRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSTSDVD
VVEAHGTGTKLGDPIEAQAVLATYGQDRPGDQPLWLGSLKSNIGHMQAAAGVGGVIKMVL
ALRHGVLPKTLHLAEPTSQVDWSEGNVRLLAEAMPWPEHDHPRRAGVSSFGVSGTNAHLI
LEAPADSPAHQAAAGADGVVPWVLSGRTEEAVRTQAERLLEFVEAEPALRPVDVGHSLVG
SRAAFDHRVVVVGGDRDELVAGLRAAAAGEPAPAVVRGTARTGNQAVFVFPGQGAQWLGM
AQDLYTESPVFAESMWECARALDPFVDWSLEQVLGDEAALERVDVVQPVLWAVMVSLAAV
WRSFGVEPAAVVGHSQGEIAAACVAGGLSLADGARVVALRSRAIADTLAGGGGMVALPLS
AARAEELLAERPGISVAAVNGPASVVVAGGAEAVDRLLADCRDEEIQARRIAVDYASHSP
SVERIEQRLLTDLAPITPESSAIPVYSSVTGEVTDTAGWDAGYWYRNLRNTVRFEEALSA
ALAAGYGAVVEVSPHPVLVPAVQDIVDERGAAVAVVGTLRRDEGTPQRMVLAVAQAYAHG
VAVDWTPAFTGRGAARVALPTYAFQHQRYWPELASGPADVSAAGLTAAEHPLLGAVVPSP
DSDAVVFTSRLSVRTHPWLADHAVRESVVFPGTGFVELVIRAGDSVGCDRLDELVLETPL
VLPAHGGVQMQVVVGDSEDEALRRSVAVYARPDGEDAWTRHATGFVGAVPPGGGGHDLFG
ILGRAWPPAGVTHVDTEGFYEQLREGGFLRYGPVFQGLRRVWRSDDQIFAEVELPESARD
SAESFGIHPALLDAAQHATAFAELGSAGTGGLPFSFGGVVLRASGAAQLRVALTRTGPDE
VTIAVADSTGAPVLSVGSMAVRPVSAGELGAGTGDRTLLRTEWVDATLSAGASSAHWLAV
GRTGEDHTGMEAAAAALDDGLPAPDAVVLAVSGDADRVVESTHELSGWVLRQLQYWLSQD
RFESIPLVVTTRGAIAAQPGETVPDLAAAAAWGLVRSAQTENPGRIVLLDTGPGSALDAG
VLGRVLAADEPQLALRDGQLLAGRLTRVGPADELAMPPDTPWRLDSTGKGALENLALLPC
PETEDPLASGQVRIRVHAAGLNFRDVLNALDMVHDARAEGPLGGEVAGVVTEVGPGVSDL
RPGDRVMGLVSGAFGPMAVTDRRFLAEVPTGWSFATAGSVPIVFLTAFYGLVDLAGLGPG
ESVLVHAGAGGVGLAAIQLARHRGAEVYATASEGKWSVLREWRVPAERLASSRDLGFRET
FRDAGVNVVLNSLAGEFVDASLDILAPGGRFLEMGKTDIRSPEDFRDRPVSYHAFDLMDA
GADRIQEMLRELVTLFEAGALRPLPVTGWDVRRAPDAFRFMSQAKHVGKLVLTVPQDLDD
AGTVLLTGGTGGLGGVLARHLVAERGVRHLLLVSRRGANAPGAADLVEELTAQGAEVTVA
ACDVTDRQALAGVLASVSPEHPLTGVVHTAGVLDDGVLGAQSQDRLDRVLAPKVDAAWHL
HELTRDLDLSLFAVFSSVAGQLGNPGQANYVAANVFLDALMQRRHREGLPGLSMAWGAWT
TEIGMVGSLSRTDLRRITRSPMPPLSAPQGMDLFDRAVATGFPLLVLTRLNMRALRAQHD
LAPLWRSLAGGALRRAADNTSHGRDELRQRLATLSGVDREELLTELVGETAAAVLGHGSG
VRIDAERPFSELGFDSLTAVELRNLLKAKTGAVLPASVVFDYPTVARLARYVGTFFGEAE
VPEPAEVSEAAVRAALGSIPLAKLRKARLLDALLELARDGDEPAVDRREEEELLLAADVG
DLVDIALRAE
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGACTGCGTCTGTGGACAGGCTGACGGAGGCCCTGCGCGCTTCACTGCTGGCCAACAAA
AGGCTGAAGCAGGAGAACAAAGCCCTGACCGAGGCGGCGCACGACCCGGTCGTCCTCGTC
GGGATGGCGTGCCGGTTCCCGGGCGGTGTGCGGGGGCCGGAGGACCTGTGGCGGCTGGTC
GCGAACGGGGCCGAGGGCATCGGCCCGTTCCCCCTGGACCGAAGCTGGGACCTCGATGCC
CTGCTGGGCACCGACGGCCCCGGTTCCGGGATCTCGGCGACGGGCGAGGGCGGGTTCCTC
GAGGGGCCGGGTGACTTCGACGCGGCGTTCTTCCGGATGTCGCCGCGGGAGGCGCTGGCG
ACCGATCCGCAGCAGCGGCTGTTGCTGGAGGTCTCGTGGGAGGCGCTGGAACGCGCCGGG
ATCGATCCCTCGTCGCTGGCCGGGAGCCGGACCGGGGTGTTCGCCGGCGTCTACCAGTCC
GGTTACAACGAGCTTCTCTCGCATGCCGACGAGCAGTTGCGCGGTCACCAGATCACCGGT
GGCGCGCCGAGCGTGATCTCCGGCCGGGTCTCCTACACCCTCGGGCTGGAGGGCCCCGCG
GTGAGCGTGGACACCGGCTGCTCCTCGTCCCTGGTCTCGATGCACCTGGCCGCCCAGGCG
CTGAGGGCGGGGGAGTGCACGCTGGCGCTGGCCGGCGGGGTCGCGGTGATGGCCGCGTCC
GACGCGTTCGTCGGGTTCACGGCACAGGGCGGCCTCGCCACCGACGGCAGGTGCAAGTCC
TTCGCCGACGCCGCCGACGGCACGGGATGGTCGGAGGGTGTCGGGATCGTGGTGATGGAG
CGGCTGTCCGCCGCCCGCCGCCACGGCCATGAGGTGCTGGCGGTGTTCCGTTCGAGCGCG
ATCAACCAGGACGGTGCCTCCAACGGCCTGACCGCGCCGAACGGGCCGTCGCAGCAACGC
GTGATCCGGCAGGCGCTGACCGCCGCCGGTCTGTCCGCTTCGGACATCGACGCGGTGGAA
GCCCACGGCACAGGGACGAGGCTGGGTGACCCGATCGAGGCGCAGGCGCTGCTGGCGACC
TACGGTCAGGACCGCCCCGAGGGACGGCCGCTGTGGCTCGGCTCGCTGAAGTCCAACATC
GGCCACACCCAGGCGGCCGCCGGTGTCGGTGGCGTGATCAAGATGGTCATGGCGCTGCGG
CACGCAGTGCTGCCGAAAACGCTGCACGTGGACGCGCCGACCACGCAGGTCGACTGGGCG
CAGGGCGACGTGCGCCTGCTGACCGAATCCCGGCCCTGGCCCGAAAGCGGCCACCCCCGG
CGTGTCGGGGTGTCGTCGTTCGGCGTCAGCGGAACGAACGCGCATGTGATCCTCGAAGCG
CCCACCGACGCCGGCTCGCCCGCCGCGGCCCCGTCCGGCCCCGGTGTTTTCGGCGCCGCA
GGCATGGTGCCCTGGATCCTGTCGGGGAAGACCGAAGACGCCGTGCGCGCTCAGGCGGCG
AAATTGCTGGCGCATCTGGAAGCGGAACCGGCGCCGGGCCCGGTCGACGTGGGTTGGTCG
CTGGTCACCACGCGGGCGATGTTCGAGCACCGCGCCGTGCTGCTGGGCACCGAGCGCGAC
GAACTGCTGACCGGGCTGAGGGCTGTCGCGTCCGGTGAATCCGCTCCGGGCACGACGCTG
GGCACAGCGGCCGAGGACAACCAACTGGGCGTGTTGTTCACGGGGCAGGGTGCGCAGCGG
GTCGGGATGGCGCGTGGGCTCTATGGGGAGTCGCCGGTGTTCGCGGCGGCGTTGGACGAG
GTCTGTGCGGAGCTGGATCCGTTGTTGGACCGGCCGTTGTGTGAGGCGATGTGGGGCGAG
GACGCGGAGCTGATCAACGAGACGGGGTGGGCGCAGCCGGCGTTGTTCGCGGTCGAGGCG
GCGTTGTTCGAGGTGCTGCGGGCGTTCGGGACGACCCCGGACTATCTGCTGGGACATTCG
ATCGGTGAGGTCACGGCGGCCTACATCGCGGGTGTGTGGTCGTTGAGCGACGCGTGCCGG
GTGGTCGCCGCGCGGGCGCGGTTGATGCAAGCGCTGCCTTCGGGCGGGGCGATGGCAGCG
ATTTCGTTGCCGGAGGCCGAAGTTGTCGAGTTGCTGCCGGAGAGCGTGTCGGTCGCGGCG
GTCAACACCGCGGATTCGGTGGTGATCTCCGGACCGCGCGAAGCCGTGGACGGTGTCGTC
GAGGTCGTGTCCGGGCAGGGACATCGGGTGTCGCGGCTGCGGGTGTCGCACGCGTTCCAT
TCGTCGTTGATGGAGCCGATGCTGGCGGAGTTCCAGCAGGTTCTGGAGTCGGTGAGCTTC
GCGCCGCCGCGGATTCCGGTGGTGTCGAACCTGACCGGGGTCCGGGCGACGGACGAGGAG
TTGTGTTCGCCGGAGTACTGGACCCGTCAGGTGCGGTCGGCGGTGCGGTTCGCCGATGGC
GTGCGCTGGTTGGGCGAACAGGGTGTCACGGCGTTGGTCGAGCTCGGGCCGGACGGTGTG
CTGTCGGGCCTGGCGCGGCAGAGCTGCCCGCCGGAGACGGTCGTCGTGCCGTTGCTGCGC
CGCGAACAGGGTGACGTGCCGACCCTGGCGTCGGCGTTGGCCCACCTGTGCGCGCAGGGC
GTCGAAGTGGACTGGACCACGCTGTTCGCCGGCCGTGACGTCACGCGGGTGCCGCTGCCG
ACCTACGCCTTCCAGCACCAGCGGTACTGGCACACCTCCAGCGGTTCGGGCGACGTGTCG
GCGGCCGGCCTGACGGCAGCGGAGCATCCGCTGCTGGGGGCGATGCTGCCGTTGCCACAG
ACGGACGGGCTCGTGTTCACCAGCCGGCTCTCGGTGCGCACCCACCCCTGGTTCGCGGAT
CACATGGTGCGTGGTGCCGTGGTGTTCCCCGGCGCCGGTCTCGTGGAGCTGGTGATCCGA
GCCGGCGACAGCGCCGGCTGTGACCGCCTCGACGAGCTGGTGCTGGAGACTCCGCTCGTC
CTGCCCGCGCAAGGCGGAGCTCAGCTTCAGGTCGTCGTCGGCGAGGACGACGCGCATCGG
CGCGCTGTCGCGGTGTACGCCCGGCCGGACGGCGAAGAGACCTGGACCCGGCACGCCACA
GGCACCGTGAGCTCGGCCGCGACCGGGCCCGCGGACGACGCTCCGTTCGACGTGCTCGGT
CGGCAGTGGCCCCCGGCGGGCGCGGCGCCACTGGACACCGAGCGCTTCTATGAGCGGCTC
GGCGGTGGTGAGTTCGCCTACGGACCGGCGTTCCGGGGTCTGCGCGAGGCATGGCGGGAC
GGTGACCGGATCCTCGCCGAGATCGAGCTGCCCGAGCCCGGCCGCGGTTCGGCGGAGTCG
TTCGGAATCCACCCCGCTCTGCTGGACGCGGCATTGCACGCGATGGTCTTCGCGGACCTG
GAGTCGGCCGGGGTCGGCTGGCTGCCGTTCAGCTTCGCCGACGTCGTGCTGCGGGCCTCG
GGCGCCTCGCGGTTGCGGGTGGCGCTGACCCGGACGGGTTCGGACGAGGTCACCATCGCG
GTCGCGGACGACACCGGGGCGCCCGTGCTGTCCGTCGGCTCGCTCGCCGTGCGGCCGCTG
GCCGCCGGCAGCCTCGCCGCCGGTGACGTCGGCACTCTGCTGAAGCCGGAGTGGACCGCG
ATCACCGGCACCGTCGCCGCGGTGGACGAGTGGCTGGTCGCGGATCCCGCCGACGTGACC
GCCGTGGCGGCCGACGCCGAGCCCCAGGCGGTGGTGCTGGCGGTTTCCGGCGACCCGGAG
GCAGTGGTCGCTTCCACACACGAGCTGACGGGCCACGTGCTGCGGCAACTGCAGCAGTGG
CTGTCGGACGACCGGTTCGCCTCGATCCCGCTGGTGGTCGCGACCTCGGGTGCGATCGCC
GCGGAGCGGGAGCCGGTGCGCGACCTGGCCGCCGCGGCGGTGTGGGGCCTGGTGCGGTCG
GCGCAGACGGAGCACCCCGGCCGCTTCGTCCTGCTCGATGCCGACTGCGCCGTGGACGCC
GACGTGCTGGGTCAGGTCCTGGCCGCCGACGAGCCGCAGCTGGCGGTGCGGAAAGGGCAG
CTTCTCGCGGCCCGGCTGACGAGAACCGGACCGGCCGACGAGCTGGCCGCGCCGCGGGAC
AGGCCGTGGCGGCTGGAGTCCACCGAGAAGGGCATGCTGGAGAACCTCGCGTTGCTGCCG
TGCCCCGAAGCGGTTGAGCCGCTGGAGAGCGGGCAGGTCCGGATCCGGGTGCACGCGGCC
GGCCTGAACTTTCGCGATGTGCTCAACGCGCTGGGGATGTACCCCGGCAAGGCGGGACCG
CTGGGCGGCGAGGCGGCGGGCGTGGTCACCGGGACCGGCACCGGTGTGACCGGCCTGCGC
GTGGGCGACCGCGTGATGGGCCTGGTCCCCGGCGGGTTCGGGCGCGTCGCGGTGACCGAT
CACCGGCTCCTGACGGTGGTGCCGGACGGATGGTCGTTCACCACGGCCGCCTCCGTGCCG
ATCGTGTTCCTCACGGCCTACTACGGCCTGGCCGATCTCGCGGGTCTTCGCACCGGGGAG
TCGGTCCTGGTGCACGCGGGTGCCGGTGGTGTGGGTCTGGCGGCGATCCAGGTCGCGCGG
CACCTCGGTGCGGAGGTCTACACCACTGCGAGCGAGGGCAAGTGGGACGTCCTGCGTGAG
TGGGGTGTTCGGCCGGAACGCCTCGCGTCCTCGCGGGATCTGGGCTTTCGCGAGGCTTTC
CGCACCGCCACCGCCGGACGGGGCGTCGACGTTGTGCTCAACTCCCTGGCGGGGGAGTTC
GTGGACGCCTCGCTGGACGTGCTCGCGTCCGGCGGCCGGTTCGTGGAGATGGGCAAGACC
GACGTCCGGCCGGCCGAGAGCCTCACGGACCGGTACCCCGGCCTGAGCTACCACGCCTTC
GACCTGAGCGACGCCGGCGCCGAGCGCGTCCAGCGCATGCTGCGGGAACTCGTCGACCTG
TTCGAAGCCGGCGTCCTGCGGCCGCTGCCGGTGACCACGTGGGACGTGCGGCAGGCGCCG
GAGGCGTTCCGGTTCATGAGCCGGGCCAGGCACGTCGGCAAGTTGGTACTGACCGTGCCG
CACGAGCCGGACGCCGCGGGCACCGTGGTGATCACCGGTGGCACCGGCGCTCTGGGCGCT
GTGGTGGCGCGGCATCTGGTCGGCGAGCACGGTGTCCGGCACCTGATGCTGCTGAGCCGC
CGTGGCCCGGATGCCCCGGGAGCAGCGGAGCTGGTCGCCGAGCTGGCCCGCCACGGCGCC
GAGGTCACGGTGGCCGCGTGTGACGTGACGGATCGGCGGGCGTTGGCGGACGCGCTCGCG
TCCGTCACCCCGGAGCATCCGCTGACCGGGGTGGTGCACACAGCGGGGGTGGTCGACGAC
GGGGTGCTCGGCTCCCTGTCGCAGGACCAGGTGGACCGGGTCCTGTCGCCGAAGGTGGAC
GCGGCCTGGCACCTGCACGAGCTGACCCGGGACCTGGATCTCCCGCTGTTCCTGGTGTTC
TCGTCGCTCAGCGGGGTGCTCGGCAGCGGCGGCCAGGCGAACTACGCGGCGGGCAACTCG
TTCCTGGACGCACTGATGCAGCGGCGGCGGGACCTCGGGCTGCCCGGACTGTCGATGGCA
TGGGGGCCGTGGACCACCGAGATCGGCATGGCCGGCGCCTTGTCGCGGACCGACCTCCAG
CGGCTCGCGCGTTCGGCGATGCCACCACTGACCACGGAGCAGGGCATGGACCTGTTCGAC
CGGGCGGCGCGTTCCGCGCAGCCGGTACTGGGACTCGCCCGCCTGAATCTGCCGGCACTG
CGCAAACAGCAGGACCTGCCCGTGTGGCGCACGCTGACGGGCGGGCGCAGGCGCGCCGCG
AACCGCCGCTCCACCGGCAGGGGACTGGGCGGGCAGCTCGCGTCGATGTCCACAGCGGAC
CGTGAGCGGGCGCTGGCCGAGCTGGTCCGCGAATCCGCCGCCACGGTGCTGGGACACAGC
TCGGGTGCCGGGATCGATCCGGCCCGGCTCTTCAGCGACCTGGGGTTCGACTCGCTGACC
GCCGTCGAGCTGCGGAACCTGATCCAGGCCAGGACCGGGATCGCCCTGGTGGCCGGCGTG
GTGTTCGACCACCCGACCGTCACCCGGCTCGCCGGGCACCTGGCGGACCGGTTCGGCGAC
TCGCGCACGACGGGGCCGACCGCCGTGCCGGAGCCGGTGTCCGGGGCCGCCGACCCGATC
GTGCTGGTCGGGATGGCGTGCCGGCTCCCGGGAGGGGTCACGGGTCCGGACGACCTCTGG
CGGCTCGTCAGTGAGGCGGGAGACGGGATCGGCCCGTTCCCGGTCGATCGCGGCTGGGAC
CTGGACGAGCTGGTGAGCCCGGACGGGACCGGCATGTCGGCCACCGGCGAGGGCGGCTTC
CTCACGGGCGCCGACGAGTTCGACGCGCCGTTCTTCCGGATCTCGCCCCGCGAGGCGGTG
GCGACGGACCCGCAGCAGCGGTTGCTGCTGGAGGTCTCGTGGGAGGCGCTCGAGCAGGCG
GGCATCCTCCCGGAAACGCTGGCGGGCAGCCGGACGGGGGTGTTCACCGGCGCCTACCAG
ATGGGCTACGGCGAACTTGTCGCCCGGTCCGACGACCAGCTGCGAGGACACCAGATCACC
GGCGGCGCGACAAGCGTGATCTCGGGCCGGGTCGCCTACACGCTCGGGCTTGAGGGGCCG
GCGGTGAGCGTGGACACGGCGTGCTCCTCGTCACTGGTCGCCATGCACCTGGCGGCGCAG
GCTCTGCGCGCCGGTGAGTGCTCGCTCGCGCTCGCCGGTGGTGTCACGGTGATGGCCACA
CCGGAGGCGTTCGTCGGGTTCACGATGCAGGGCGGGCTGTCCGCGGACGGCCGGTGCAGG
TCCTTCGCCGAGACCGCGAACGGGACCGGTTGGTCCGAAGGCGTGGGCGTGGTGGTGATG
GAGCGGCTGTCGGACGCCCGCCGCAACGGTCATGAGGTGCTCGCGGTTTTCCGTTCGAGC
GCGGTGAATCAGGACGGTGCGTCGAACGGTTTGACGGCGCCGAACGGTCCGTCTCAGCAG
CGGGTGATCCGGCAGGCGCTCGCCGCGGCCGGCCTGTCCGCTTCGGACGTGGATGTGGTG
GAAGCGCATGGCACCGGGACGCGGCTGGGTGATCCGATCGAGGCCGACGCGCTGCTGGCG
ACGTACGGTCAGGATCGGCCGGAAGACCGTCCGTTGTGGCTGGGCTCGCTGAAGTCGAAC
ATCGGGCACGCGCAGGCGGCCGCGGGTGTCGCGGGTGTGATCAAGATGGTGTTGGCGCTG
CGCCACGGAGTGCTGCCGAAGACCCTGCACGCCGAGCGGCCGACCACGCAGGTGGACTGG
GCGCGGGGCGAGGTGCGGCTGCTGACCGACGCCGTCCCGTGGCAGGAGAACGGGCATCCG
CGCCGGGCCGGGGTGTCGTCGTTCGGCGTCAGCGGCACGAACGCCCACGTCATCCTTGAG
GCCCCGGCCGAAACCGGCGCGCCGCACGAGGCCGCGCCGGGTACCGGTGCGGTCGGTGCC
GGCGGTGTGGTGCCGTGGGTGCTGTCGGGCCGGTCGGACGAGGCGGTGCGGGCGCAGGCC
GCCCGGTTGCTGGAGTACGTGGAGGGCGCGCCCTCGGTGCGTCCCGTCGACGTGGGCTGG
TCGCTGGTCACCTCGCGTACCGCGTTCGACCACCGGGCCGTGGTGGTGGGCGGCGACCGG
GAGGAACTGATCAGCGGAATGCGTGCGGTCGCCGGCGGTGCGCCCGGTGTCGTGCGGGGC
ACGGCTCGGTGCGGGCACCGGCTCGGGGTGTTGTTCACGGGGCAGGGTGCGCAGCGGGTC
GGGATGGCGCGTGGGCTCTATGGGGAGTCGCCGGTGTTCGCGGCGGCGTTGGACGAGGTC
TGTGCGGAGCTGGATCCGTTGTTGGACCGGCCGTTGCGCGAGGTGATGTGGGGCGAGGAC
GCGGAGCTGATCAACGAGACGGGCTGGGCGCAGCCGGCGTTGTTCGCGGTCGAGGCGGCG
TTGTTCGAGGTGCTGCGGGCGTTCGGGACGACCCCGGACTATCTGCTGGGACATTCGATC
GGTGAGGTCACGGCGGCCTACGTCGCCGGGGTGTGGTCGTTGGCCGATGCGTGTCGGGTG
GTGGCGGCGCGGGCGCGGTTGATGCAGGCGCTGCCGTCCGGCGGGGCGATGGCCGCGGTC
GGGATGTCCGAGGCGGAGATCGCCGGACTGCTGCCGGAGACGGTGTCGGTGGCGGCGGTC
AACACCGCGGATTCGGTCGTGGTGTCGGGGCCGCAGGCCGATGTCGACCAGGTGCTGAGC
CTGGCTTCGGAGTGCGATGCCCGGGTGTCGCGGCTGCGGGTGTCGCACGCGTTCCACTCG
TCGTTGATGGATCCGATGCTGGACGAGTTCCGACGGGTTTTGGAGTCGGTGCGCTTCGAG
CCACCGCGGATTCCGTTGGTGTCGAACGTGACGGGGGTGCGGGCGTCCGACGAAGAGCTG
TGTTCGCCGGAGTACTGGGTGCGGCAGGTGCGGTCGGCGGTGCGCTTCGCCGACGGCGTG
CGGTGGCTGGGCGAGCAGGGTGTCACCACGATGGTCGAGCTGGGCCCGGATGGTGCGCTC
TCCGGGTTGGCGCAGGACAGTTCGGCTGTGGCCGCCGTGCCGATGCTGCGCCGGCAGAAG
TCCGGCGGGCAGTGCGACTCGGGCCTGGTGCTGTCGGCGATCGGGCAGTTGTCCGCCCAC
GGTGTGGCAGTGGACTGGACTACGGCGTTCGCCGGTCGTGGCGCTGTCCGGGTTCCGCTG
CCGACGTACGCCTTTCAGCACCAGCGGTACTGGCCCGACACGGTGCGGGCCGCCCCGGAA
CCGTCCGAGGACCGGGCGGACCGGCGGTTCTGGGCGTCGGTCGAACACCAGGACGTGCAA
GGCCTGGCCACGACGCTGGGACTCGACGGCGGTGTCGTGGCGCCGGTCGTGCCCGCGCTG
GCCTCGTGGCGGGCTCGCCGGCACGAACAGTCCCTTGTGGACGGCTGGCGCTACCGCGAG
GTGTGGAAACGGCTGGCAGTGGCGGGAGCGCCGACGACCGGACAGTGGTTGGTCGTGGTC
CCGGAAGGCGCGCGCGACGACGCCTGGGCGGCGGAGGTGGCGCACGCCCTGGGCGCGAGC
ACACTCGTGCTCGACCACAGCGGGGCCGAGCTGACCGAGCGGCTGAAGGAAGCCGGTGAG
TCCGCTGCCGGAGTGACCGGTGTGGTGTCGCTGGCCGCCGCCCTGGAGCCGGGCATCACC
GCCGGACTGGCGGCGACGACCTCGTTGCTGCGAGCCGTGCTGGACAGCGGCCTCGCCGCC
CGGATCTGGGTGGTGACCCGCGGCGCGATGTCCGTCGGCCCCCACGACCCGGTGATCGCC
CCGGCACAGGGCGGGGTGTGGGGCCTGGGCCGGGTCGCCGCACTCGAACTGCCCGCGCTG
TGGGGCGGCCTGGCTGATCTGCCCGAGGTGCTCGACCCGCGCAGCGCGCGCTGGCTGGCC
GCCGCGCTGCCGGGGACGACCGGCGAGGACCAGATCGTGGTGCGCCCGGCAGGCGTGTTC
GGTCGCCGGCTCGTTCACGCGCCGGTGGCCGGTTCCGGTGATCCGTCGTGGACGACGTCC
GGGACGGCGCTGGTCACCGGGGGCACCGGTGAGCTGGGTGCGTACGCGGCGCGATGGCTG
GTCGAGCGCGGCGCGGAGCACGTCGTGCTCGTGAGCCGCCGTGGTCTCGACGCCGAGGGC
GCGGACGCGCTGCGGCTGGAGCTGGAGGTCGCCGGCGCCCGGGTCACCGTCGCCGCTTGC
GACGTGACGGACCGGCAAGCGCTGGCCGACGTGATGGCGGGCATCCCGGAGGAGTGGCCA
CTGCGGACTGTCGTGCACGCGGCCGGTGTCGTGAGCGAAGACCGTGCGCTCACCTCGGCG
ACCGCCGACGACCTCGACCAGCAGGTACGGGCCAAGGTCCACGGCGCGCACAACTTGGAC
GAGTTCACCCGCGAGCTGGAGCTCGACGCGTTCGTGCTGTTCTGCTCCGGTGCAGGTGTC
TGGGGCAGCGGCGGGCAGGCCGGATTCGCGGCGGCCAACGCGTACCTGGACTCGCTGGCC
CGCCACCGCAGGGCGGCGGGACGCACCGCGACCGCGATCGCGTGGGGTTCGTGGGACCAG
GTCGGGGCGCTGAGCGATCCGGGTGCTGCGCAACGCGAGCAGCTCCGCCTGCTCGGGGTC
GTGCCGATGCGGCCTGAGCTGGCAGTCGCCGCGTTGCAGCGTGCGGTGCACGACGACGAG
ACCGCGATCGTCGTCGCGGACCTGGACTGGGCGCGGTTCGCGCCCGTGTTCACCGCGGCG
CGGTCGAGCGCCTTGCTGTCCGGGCTCCCGGAGGCCGAAGCGGCACTGACCGCAACGCGG
GACGACACCGCGATCTCCGGAGAACTGCGGGACCGGCTCGCCGGACTGTCCGAGGCGGAC
CGCCGAGAGGTGCTGCTCGGCCTCGTCCGTGACTCGTCGGCGGCCGTGCTGGGCCACGGG
TCGAGCGCGGAGATCGAGAGCGACCAGCCGTTCAGCGAGCTGGGCTTCGACTCGCTGACG
GCGGTGGAGCTGCGCAACCGGTTGCAGGCGGCGACCGGGGTCGCGCTGCCCGCGAGCCTG
GTGTTCGACTACCCCACAGCGAATCGCCTCGTGGACCACCTCGCCGGCCGGTTCGGCGTG
ACGGAATCGGCCCAACCGTCGGTCGTGCCGGCGTCGGTGCCGGTCGCCGACGATCCGATC
GTGCTGGTGGGCATGGCGTGCCGGTTCCCGGGCGGGGTGTCGAGCCCGGATGCGCTCTGG
CGGCTGGTGGCCGACGGGGCGGACGGCATCACACCGTTCCCGGTCGACCGTGGCTGGGAC
CTGGACACGCTGGTGGGCACGGACGGTCCCGGTTCCGGGACGTCGGCGACGGCTGAGGGC
GGGTTCCTCGACGAGGTCGCCGACTTCGACGCGGCGTTCTTCCGGATCTCGCCGCGGGAG
GCGCTGGCGACCGATCCGCAGCAGCGGCTGTTGCTGGAGGTGTCGTGGGAGGCGCTGGAG
CAGGCGGGAATCGATCCGACCTCGCTGGCGGGCAGCTCGACCGGCGTGTTCGCCGGCGCC
TACCAGTCCGGGTATCTCGAGCTGGTTTCCCGGGCCGACGAGCAGCTGCGGGGCCATGCG
CTCACCGGTGGTGCGGGCAGTGTGATCTCCGGGCGGATCGCTTACACGCTGGGCTTGGAA
GGTCCCGCGGTGAGTGTGGACACGGCGTGTTCCTCGTCGCTGGTGGCGATGCACCTGGCG
GCGCAGGCATTGCGCGCCGGCGAGTGCTCACTGGCGTTGGCCGGCGGGGTGACGGTCATG
GCGGCGGCGGACACCTTCGTCGGGTTCAGCATCCAGGGCGGCCTGGCCGTGGACGGCCGA
TGCAAGTCGTTCTCGGACGACGCGGACGGTACCGGGTGGTCCGAGGGTGTCGGCGTGGTC
GTGCTGGAGCGGATGTCGGACGCGCGCCGCAACGGTCACGAGGTGCTGGCGGTGCTGCGG
TCGAGTGCGGTGAATCAGGACGGTGCGTCGAACGGTTTGACGGCGCCGAACGGTCCGTCG
CAGCAACGCGTGATCCGCCAGGCGTTGGCGGCGGCCGGTCTGTCCACATCGGACGTCGAT
GTGGTCGAGGCGCACGGCACCGGGACGAAGCTCGGTGATCCGATCGAGGCGCAGGCGGTG
CTGGCGACCTACGGTCAGGACCGGCCAGGGGATCAGCCGTTGTGGCTGGGGTCGTTGAAG
TCGAACATCGGGCACATGCAGGCCGCCGCGGGAGTGGGCGGTGTGATCAAGATGGTGCTG
GCGCTGCGGCACGGCGTGTTGCCGAAGACGCTCCACCTGGCCGAGCCGACCAGCCAGGTG
GACTGGTCCGAGGGCAACGTGCGGCTGCTCGCCGAGGCGATGCCGTGGCCGGAGCATGAC
CATCCGCGCCGGGCCGGGGTGTCCTCGTTCGGCGTGAGCGGGACCAACGCGCACCTGATC
CTCGAAGCCCCCGCCGACTCGCCTGCGCACCAGGCCGCCGCCGGCGCCGACGGGGTGGTG
CCGTGGGTGCTCTCGGGCAGGACCGAGGAAGCGGTGCGGACGCAGGCGGAGCGACTACTG
GAGTTCGTCGAGGCGGAACCCGCACTGCGTCCGGTGGACGTCGGGCACTCGCTCGTCGGC
TCGCGGGCCGCGTTCGACCATCGGGTCGTCGTGGTGGGCGGTGATCGGGACGAACTCGTC
GCAGGGCTGCGCGCCGCCGCTGCCGGTGAGCCCGCGCCGGCCGTGGTGCGGGGGACCGCG
CGGACCGGGAACCAGGCCGTGTTCGTGTTCCCCGGCCAAGGCGCGCAGTGGCTCGGCATG
GCGCAGGACCTGTACACGGAGTCCCCGGTGTTCGCCGAGTCGATGTGGGAGTGCGCGAGG
GCCTTGGATCCGTTCGTGGACTGGTCGCTGGAGCAGGTGCTCGGTGACGAGGCGGCGTTG
GAGCGCGTGGATGTGGTGCAGCCGGTGCTGTGGGCGGTGATGGTGTCGCTGGCCGCCGTG
TGGCGGTCGTTCGGCGTCGAGCCCGCGGCCGTGGTGGGCCACTCCCAGGGCGAGATCGCC
GCCGCGTGTGTGGCTGGTGGCTTGTCGCTGGCGGATGGGGCGCGGGTGGTGGCGTTGCGC
AGCCGGGCGATCGCGGACACCCTCGCCGGGGGCGGCGGGATGGTGGCCCTGCCGTTGTCC
GCTGCCCGTGCCGAGGAGCTGCTCGCGGAGCGGCCGGGAATCTCGGTGGCGGCGGTCAAC
GGGCCGGCGTCGGTCGTCGTCGCCGGAGGCGCGGAGGCCGTGGACCGGCTGTTGGCCGAC
TGCCGGGACGAGGAGATCCAGGCGCGCAGGATCGCCGTCGACTACGCCTCGCACTCGCCG
TCGGTGGAGCGGATCGAGCAGCGGTTGCTGACCGATCTCGCGCCGATCACGCCGGAGTCT
TCCGCGATCCCGGTCTACTCCTCGGTGACCGGCGAGGTGACGGACACCGCCGGCTGGGAC
GCCGGGTACTGGTACCGGAACCTGCGCAACACCGTGCGGTTCGAGGAAGCGCTCTCCGCG
GCGCTGGCGGCCGGGTACGGGGCGGTGGTCGAGGTGAGTCCGCATCCGGTGCTGGTGCCC
GCGGTGCAGGACATCGTCGACGAGCGCGGGGCCGCGGTGGCTGTGGTGGGCACGTTGCGC
CGCGACGAAGGGACTCCCCAGCGGATGGTGCTCGCGGTGGCCCAGGCGTACGCGCACGGC
GTGGCAGTGGACTGGACCCCTGCGTTCACCGGCCGGGGTGCGGCGCGGGTCGCGTTGCCG
ACGTACGCGTTCCAGCACCAGCGGTACTGGCCCGAGCTCGCGAGTGGCCCGGCCGACGTG
TCGGCGGCGGGGCTGACCGCCGCGGAGCACCCGCTGCTGGGCGCGGTGGTGCCCTCGCCC
GACTCGGACGCGGTGGTGTTCACCAGCCGCCTGTCGGTGCGGACACATCCGTGGCTGGCT
GATCACGCGGTGCGGGAGTCGGTGGTGTTCCCGGGAACCGGTTTTGTGGAGCTCGTCATC
CGGGCCGGCGACAGCGTCGGGTGCGACCGCCTCGACGAGCTGGTCCTGGAGACGCCGCTG
GTACTGCCCGCCCACGGCGGCGTGCAGATGCAGGTGGTGGTCGGCGACAGCGAGGACGAG
GCGCTGCGGCGGAGTGTGGCCGTCTACGCGCGCCCCGACGGAGAAGATGCCTGGACCCGC
CACGCCACCGGGTTCGTGGGCGCCGTCCCGCCGGGAGGCGGTGGACACGACCTGTTCGGC
ATCCTCGGGCGGGCCTGGCCTCCGGCCGGCGTGACACACGTGGACACCGAGGGGTTCTAC
GAGCAGCTGCGCGAAGGCGGTTTCCTCCGGTACGGCCCCGTTTTCCAGGGGCTGCGCAGG
GTCTGGCGGAGCGATGACCAGATCTTCGCCGAGGTCGAGCTGCCCGAGTCCGCACGCGAT
TCGGCCGAGTCGTTCGGGATCCACCCGGCGCTGCTCGACGCCGCGCAGCACGCCACGGCC
TTCGCGGAGCTGGGCTCCGCCGGGACCGGCGGGCTGCCATTCAGCTTCGGCGGCGTCGTG
CTCCGCGCCTCGGGTGCGGCACAGCTGCGGGTGGCGCTGACGCGGACGGGTCCCGACGAG
GTCACGATCGCGGTCGCCGACAGCACCGGGGCGCCGGTGCTGTCGGTCGGCTCGATGGCG
GTGCGGCCGGTGTCGGCCGGCGAGCTCGGCGCCGGCACCGGTGACCGGACACTGCTGAGG
ACGGAGTGGGTCGACGCCACCCTTTCGGCCGGGGCTTCGTCGGCGCATTGGCTGGCCGTC
GGTCGGACCGGCGAGGACCACACCGGAATGGAAGCGGCCGCCGCGGCTCTCGACGACGGC
CTGCCGGCGCCGGACGCGGTCGTGCTGGCCGTTTCCGGTGACGCGGACCGGGTGGTCGAG
TCCACGCACGAGCTGAGCGGCTGGGTGCTGCGCCAGCTGCAGTACTGGCTGAGCCAGGAC
CGCTTCGAGTCGATCCCGCTGGTGGTGACGACACGGGGCGCGATCGCCGCGCAGCCTGGC
GAAACGGTGCCGGACCTGGCTGCCGCCGCGGCGTGGGGACTGGTGCGCTCGGCGCAGACC
GAGAATCCCGGCCGGATCGTGCTGCTCGACACCGGCCCGGGCAGCGCGCTCGACGCCGGG
GTGCTGGGCCGGGTCCTGGCGGCGGACGAGCCGCAACTGGCGCTGCGCGACGGACAGCTC
CTCGCGGGTCGGCTCACCAGGGTCGGCCCGGCCGACGAGCTCGCGATGCCGCCGGACACC
CCGTGGCGGCTCGACTCGACGGGCAAGGGTGCGCTGGAGAACCTGGCCCTGCTGCCGTGC
CCCGAGACCGAGGATCCCTTGGCCTCCGGGCAGGTTCGCATCCGGGTCCACGCGGCGGGC
CTGAACTTCCGGGACGTGCTCAACGCGCTGGACATGGTGCACGACGCGCGTGCGGAGGGC
CCGCTGGGCGGCGAGGTCGCGGGTGTGGTCACCGAGGTCGGCCCCGGCGTGTCCGATCTG
CGGCCCGGCGACCGGGTCATGGGCCTCGTCTCGGGGGCGTTCGGCCCGATGGCCGTCACG
GACCGGCGGTTCCTGGCCGAGGTGCCGACGGGCTGGTCGTTCGCGACCGCGGGGTCGGTG
CCGATCGTGTTCCTGACCGCCTTCTACGGCCTGGTGGATCTTGCCGGGCTGGGCCCCGGT
GAGTCGGTCCTGGTGCACGCCGGCGCCGGCGGTGTCGGCCTGGCGGCGATCCAGCTCGCA
CGGCACCGGGGGGCGGAGGTCTACGCCACGGCGAGTGAGGGCAAGTGGAGTGTCCTGCGG
GAGTGGAGAGTCCCGGCCGAGCGGCTGGCCTCTTCGCGCGATCTCGGCTTCCGCGAGACG
TTCCGGGACGCGGGTGTGAACGTCGTCCTGAACTCGCTCGCGGGGGAGTTCGTGGACGCG
TCGCTCGACATTCTGGCTCCGGGTGGGCGGTTCCTGGAGATGGGCAAGACCGACATCCGA
TCGCCGGAGGACTTCCGCGACCGGCCGGTGAGTTACCACGCCTTCGACCTGATGGACGCG
GGCGCCGACCGGATCCAGGAGATGCTGCGGGAGCTGGTGACACTGTTCGAGGCCGGCGCG
TTGCGGCCGCTGCCGGTCACGGGCTGGGATGTGCGCCGGGCACCGGATGCGTTCCGGTTC
ATGAGCCAGGCCAAACACGTCGGCAAGCTCGTCCTGACCGTCCCGCAGGACCTCGACGAC
GCGGGCACCGTCCTGCTGACCGGCGGGACCGGTGGCCTGGGCGGTGTGCTCGCCCGCCAC
CTCGTCGCCGAGCGCGGCGTCCGGCACCTGCTGCTGGTCAGCCGCCGCGGCGCCAACGCC
CCTGGGGCCGCGGACCTGGTCGAGGAGTTGACGGCGCAGGGCGCGGAGGTGACCGTCGCG
GCGTGTGACGTGACCGATCGGCAGGCACTGGCCGGGGTGCTCGCCTCGGTGTCGCCGGAG
CATCCGCTCACCGGTGTGGTGCACACCGCCGGCGTCCTCGACGACGGGGTGCTCGGGGCG
CAGTCGCAGGACCGGCTGGACCGGGTGCTGGCACCGAAGGTGGACGCGGCCTGGCACCTG
CACGAGCTGACCCGGGACCTGGATCTCTCGCTGTTCGCGGTGTTCTCCTCCGTCGCCGGG
CAACTGGGCAACCCGGGACAGGCCAACTACGTCGCCGCCAACGTGTTCCTGGACGCCCTG
ATGCAGCGGCGCCACCGCGAGGGCCTGCCCGGGCTCTCGATGGCCTGGGGCGCATGGACC
ACCGAGATCGGCATGGTCGGTTCGCTGTCGAGGACCGACCTGCGCCGCATCACGCGGTCG
CCGATGCCGCCGTTGTCGGCTCCGCAGGGCATGGACCTGTTCGACCGGGCCGTCGCCACC
GGTTTCCCCCTGCTGGTGCTGACCCGGCTGAACATGCGCGCTCTGCGTGCCCAGCACGAC
CTCGCGCCCCTGTGGCGGTCGCTGGCGGGCGGAGCGCTGCGGCGAGCCGCCGACAATACG
AGCCACGGGCGGGACGAACTGCGGCAGCGGCTGGCGACACTGTCCGGTGTGGACCGTGAG
GAGCTGCTGACCGAGCTGGTCGGCGAAACCGCCGCGGCTGTGCTGGGCCACGGCTCGGGC
GTGCGGATCGATGCGGAACGGCCCTTCAGTGAGCTGGGTTTCGACTCGCTGACGGCCGTC
GAATTGCGCAACCTGCTGAAGGCCAAGACCGGTGCCGTGCTGCCCGCCAGCGTCGTTTTC
GACTATCCGACCGTCGCGCGGCTGGCGCGCTACGTGGGCACGTTCTTCGGTGAGGCCGAG
GTTCCCGAACCGGCGGAGGTGTCGGAGGCGGCGGTGCGCGCGGCGCTCGGCTCGATCCCG
CTGGCGAAGCTGCGGAAGGCCCGGCTGCTGGACGCGTTGCTCGAACTGGCCCGCGACGGC
GACGAACCTGCGGTCGACCGGCGAGAAGAGGAAGAACTCCTGCTCGCGGCGGATGTCGGC
GACCTCGTCGACATCGCGCTGCGGGCCGAATGA
[7] KS35..411
[7] AT572..883
[7] malonyl-CoA757..761
[7] DH929..1094
[7] ER1391..1697
[7] KR1707..1887
[7] ACP1981..2055
[8] KS2078..2451
[8] AT2611..2902
[8] malonyl-CoA2796..2800
[8] kr3221..3401
[8] ACP3505..3575
[9] KS3598..3973
[9] AT4127..4443
[9] methylmalonyl-CoA4315..4319
[9] DH4490..4658
[9] ER4970..5272
[9] KR5282..5462
[9] ACP5559..5633
[7] KS103..1233
[7] AT1714..2649
[7] malonyl-CoA2269..2283
[7] DH2785..3282
[7] ER4171..5091
[7] KR5119..5661
[7] ACP5941..6165
[8] KS6232..7353
[8] AT7831..8706
[8] malonyl-CoA8386..8400
[8] kr9661..10203
[8] ACP10513..10725
[9] KS10792..11919
[9] AT12379..13329
[9] methylmalonyl-CoA12943..12957
[9] DH13468..13974
[9] ER14908..15816
[9] KR15844..16386
[9] ACP16675..16899

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [563-692]  G3DSA:3.40.366.10 [757-871]  G3DSA:3.40.366.10 [2609-2728]  G3DSA:3.40.366.10 [2795-2900]  G3DSA:3.40.366.10 [4118-4247]  G3DSA:3.40.366.10 [4315-4430]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1519-1540]  PS01162 [5100-5121]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2013-2028]  PS00012 [3533-3548]  PS00012 [5591-5606]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1983-2059]  1.80000000000002e-63 G3DSA:1.10.1200.10 [3503-3577]  1.80000000000002e-63 G3DSA:1.10.1200.10 [5562-5632]  1.80000000000002e-63 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1981-2055]  PS50075 [3505-3575]  PS50075 [5559-5633]  PS50075
PS50075   ACP_DOMAIN
 [1978-2094]  2.90000354677981e-24 SSF47336 [3498-3614]  5.39999384454126e-28 SSF47336 [5555-5650]  7.19999557654549e-19 SSF47336
SSF47336   ACP_like
 [1988-2054]  1.8e-09 PF00550 [3513-3574]  3.90000000000001e-13 PF00550 [5569-5632]  3e-11 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1405-1537]  5.39999384454126e-30 SSF50129 [4956-5118]  4.30000170645867e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [5111-5217]  3.1e-14 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1411-1466]  5.3e-06 PF08240 [4990-5048]  2.5e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1707-1885]  2.89999999999999e-64 PF08659 [3221-3400]  3.7e-58 PF08659 [5282-5460]  8.30000000000004e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1.39999999999997e-84 PF00109 [2078-2326]  2.09999999999996e-88 PF00109 [3598-3848]  5.09999999999993e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  8.1e-46 PF02801 [2334-2451]  5.69999999999998e-48 PF02801 [3856-3973]  1.9e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-883]  1.2e-61 PF00698 [2611-2904]  6.19999999999994e-60 PF00698 [4127-4443]  4.30000000000003e-102 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [567-874]  1.50000965748778e-71 SSF52151 [2607-2888]  5.6999970878395e-72 SSF52151 [4125-4413]  9.90001804798383e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-756]  1.80000149287196e-16 SSF55048 [2733-2795]  1.80000149287196e-15 SSF55048 [4250-4314]  1.09999909120787e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-295]  G3DSA:3.40.47.10 [299-461]  G3DSA:3.40.47.10 [2078-2336]  G3DSA:3.40.47.10 [2340-2502]  G3DSA:3.40.47.10 [3597-3858]  G3DSA:3.40.47.10 [3862-4024]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  6.80004680300024e-96 SSF53901 [2077-2504]  7.90003079443025e-100 SSF53901 [3597-4026]  1.3000049540733e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1527-1620]  3.40000000000004e-36 G3DSA:3.40.50.720 [1708-1893]  5.90000000000008e-114 G3DSA:3.40.50.720 [3220-3407]  5.90000000000008e-114 G3DSA:3.40.50.720 [5108-5199]  3.40000000000004e-36 G3DSA:3.40.50.720 [5282-5463]  3.39999999999996e-107 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [2239-2255]  PS00606 [3761-3777]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-863]  4.50001022902825e-120 SM00827 [2611-2900]  2.0000139277205e-117 SM00827 [4129-4423]  3.39999972437719e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1986-2058]  1.99999636034521e-28 SM00823 [3506-3578]  1.49999648196323e-34 SM00823 [5564-5636]  6.69999687625999e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [929-1094]  2.7000136937899e-77 SM00826 [4490-4658]  8.89993011983204e-75 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [2080-2504]  SM00825 [3600-4026]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1707-1887]  1.70000295590053e-63 SM00822 [3221-3401]  1.90000694315261e-44 SM00822 [5282-5462]  1.39999277195148e-67 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1391-1697]  SM00829 [4970-5272]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit