close all open/close all

CDS information : Tauto_00110


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction76,329 / 43,846 / - [in whole cluster]
76,329 / 43,846 / - [in contig]
Locationcomplement(43846..76329) [in whole cluster]
complement(43846..76329) [in contig]
TypeCDS
Length32,484 bp (10,827 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)ttmJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionPKS/NRPS Module

0
1 methoxymalonyl-ACP
2 malonyl-CoA
3 methylmalonyl-CoA
4 malonyl-CoA
5 methylmalonyl-CoA
6 methylmalonyl-CoA
AT104..421
ACP470..540
KS563..936
AT1092..1413
dh1461..1626
KR1912..2092
ACP2188..2258
KS2283..2657
AT2816..3124
KR3425..3605
ACP3709..3779
KS3802..4174
AT4329..4642
dh4690..4856
kr5145..5315
ACP5396..5466
KS5491..5867
AT6025..6336
dh6383..6544
KR6828..7006
ACP7103..7177
KS7199..7574
AT7743..8059
DH8106..8272
ER8594..8900
KR8910..9089
ACP9190..9260
KS9283..9651
AT9815..10128
KR10429..10609
ACP10709..10783

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MRSAHIEQPIGSGPDRLPLLLPGGHPESVRAHAGRLAEYLDARADVRPADVGAALRAMAA
TGPHRAAVVAADRAGFADGLRALAAGHGAPGLVEGTALGGPVAFVFPGQGGQWPGMARDL
LAESPVFRARLDDCTQALEPFVDWSLLDVLRDPAPPGRVDVVQPALFAMMVALADVWLSH
GIEPTAVAGHSLGEVAAAVVADALSLDDGARVAALWSRAQATIEGRGEMVSVRAPEQLVR
ERLAAWPDALVVAAINGPATVLVSGDTAAAAELVAALTADGIPARRVATGLAAHSPQIEQ
ILPSMRRDLEPIRPRPPRLPFYSAHLGARLPGDAVALDAEYWCGNLRHPVRFEEATRALL
ADGCRVLVEVSPHPVLTAAMQETVESGPVAATVCGSLRRDQGDLRRFLLSLGEAYVGGAE
PGGDALYAGHAPVPPADLPVAGTGTGQSSSDPSLYGELAGLERARRQAVLTELVCREVAL
ALGVGEADAVDPDRPFRDLGFDSVTVVEVRNRVSAASGLTLPVTVTFDHPTPAALAAALA
ERLFGPDPGAGHEPDRLTSATEDPVVIVGMGCRYPGGAHGPDRLWELVASGADALTPFPA
NRGWDVTGTYAPETDRTGHHYQREAGFVHDADLFDADFFGISPREATVMDPQQRLLLETS
WETFEHAGIDPTSLRGSRTGVFIGAMTLEYGPGTGDDTGFGGYVFTGTTGSVHSGRIAYS
LGLEGPAVTVDTACSSSLVALHLAVQALRAGQCDLAVAGGATVMPNLGMFVEFSRQGGLA
GDGRCKAFSAAADGFGLAEGVGLLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAP
NGPSQQRVIRQALADAGLAPSDVDVVEAHGTGTRLGDPIEAQTILATYGQDRERPLWLGS
VKSNLGHTQAAAGVAGIIKMVQAMRHGLLPKTLHVDEPTPHVDWSAGAVRLLTDPTPWPD
DGRPHRAAVSSFGVSGTNAHVILEAPEKAVPDATPEAPSDSVAVPWVLSGKSDAAVRAQA
ARLLEFVEADPALRTVDVGWSLVSSRSLFEHRAVVAGSGRDELLAGLRNAVAGESAPGVA
RGIARPGGVKTVFVFPGQGAQWAGMGRDLMASSPVFAARLRECADALAPYVDWDLAEVVG
GAEGAPGFERVDVLQPVSWAVMVSLAALWRSFGVEPSAVVGHSQGELAAAVVGGYLTLED
AARIVARRSRMITEELTGRGGMLSVLMGVDWVTEALRPWAGRLWIAAVNGPASVSVSGDA
EALGEFGRVLSKARVHRWQLPGVDFAGHSGHVDAIEERLRAELADITARPGEVPWMSTVD
GQWADHARVDADYWYRNLRDVVRFEDATEALIASGHRVFVEVSTHPVLTTAIGEVAEAHQ
DPGIAVAGTLRRDDGGAGRFVAALAEVVAAGVDADWAAVFAGTGTKRVPLPTYAFQRKRF
WFDTAEVPTDVTAAGLSPAEHPLLGAKVPLPHTDGVLFTSRLSLRTHPWLAGHTVRDTVL
FPGTGYVELAVRAGDSVGCDRLDELALDTSLVVPAEGGVRVQVVVSDADADSRRSVAVYA
CPDGQEVWTRHATGVLGTGASADADADFDIVTGVWPVPGATEVDTSSLSDRLDAAGFAYS
PLFQGLTRAWRHGDRILAEAGLPADAGAESFGIHPALLDSAVRTGSLTGVDGLPAGFTDV
VLRASGASRLRVVLTRTGPDEVSLAAADAAGLPVLSIGSLTVRPPTAQSVSTGLGDGALV
KLDWPGIAATAAAVADRLVVDRPGSIADAVAAGPLPPVVVLPVSGDPDAVVESVHDVTGW
VLEQVQHWLSDERFAATPLVVATTGAIAVRPGDTVTDPAAAAVWGLVRSAQTENPGRFVL
VDTDAELDTAVLGRILAADEPQLALRAGRLHAARLTRVSPADGAGPALDGAGTVVITGGT
GGLGGLFARHLVTEHGVRHLLLLSRRGPDAPGVTELVADLARLGAETIVSACDVTDRRAL
ADALASVAEEHPVTGVVHAAAVLDDGVIGSLSRRQLDRVLAPKADAAWYLHELTRDHDLS
LFAVFSSVAGLTGNGGQGNYAAGNVFLDALMQQRHDAGLPALSMAWGPWTTEVGLVGSLS
DTDLRRIARSAMPELPVAQGLALFDRALRAGAPVLGLTRLNIGALRAQADVPAVWRSLAG
GTRRRAADNTTDSTRLAGLSGAECRRVLVDMVREAAAAVLRHDAGTEISTTQPFKALGFD
SLTSVELRNLLRARTGLALPTGVVFDYPTVARLAEYLSGRLGQPPAAEPEVRPAVVPAPM
ADDPVVLVGMACRYPGGVSDPAGLWQLVVEEADAITPFPADRGWDLAALRGTDGPGLSAT
EQGGFLDAVGDFDAAFFGISPREALATDPQQRLLLEVSWEALEHAGIDPAALAGSQTGVF
TGVYQSGYGDLLSRSAQRLQGHLLTGSLASVLSGRVSYVLGLEGPAVSVDTACSSSLVAM
HLAAQALRAGECSLALAGGVTVMAGSEGFVEFTAQGGLSADGRCKSFADAADGTGWSEGV
GLVVLERLSDARRHGHEVLAVLRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSAS
DIDVVEAHGTGTRLGDPIEAEAILATYGQNRPGDRPLWLGSLKSNIGHTQAAAGVGGVIK
MVMAMRHGVLPRTLHVDEPSARIDWSQGDVRLLTEAMPWPENGHPRRFGVSSFGISGTNA
HAILEAPAGSPTEPAATGAASVLADGVPWVLSGKSEDALRAQAARLLEFVEADPSRSAVD
VGWSLAHSRSAFDHRVVLAGADRDELVAGLRAVAVGGPAPGAVRDTVRPEPRVGVLFPGQ
GAQRIGMARDLYDRSAVFASTVDMILAELDPLLDRPLREVMWGEDAELVNETGWAQPALF
TVEAALFEVVRAFGVTPDYLLGHSIGEITAAYVSGVWSLADACRVVAARARLMQALPAGG
AMAAVGLSEAEVADLLPGGVSIAAVNTADSVVLSGPRDDVERVTAAAAERGAKVTRLRVS
HAFHSSLMDPMLAEFAGVLESVEFRPPRIPVVSNLTGEPAAEDLCSPEYWVRQVRGTVRF
ADGVRSLAEQGVTALVELGPDAVLSGPAQHSCAPGTVVAPMLRRGHDDVCTVLSALGLVY
AQGVSVDWAGVFAGRGAARVPLPTYAFQRQRFWPEPSPVASRASVDPADEQLWTSVEQQD
VEALADALGLDSAEAASVLPALASWRTRRRDESTTDGWRYRESWKPLGAPTAATPGHWLV
VVPAGAGDDAGTREIVDALGAGTRVLEHSGPDRAALAGKLSDAAGSGVPVAGVLSPAALE
PDTATGLVSATLLLRALRDTGLSARLWVVTRGAVSIGSHDPVTAPGQGAFWGFGRVAALE
EPELWGGLVDLPGTLDLRTARRFAAAVSDTAGEDQIAVRSSGWYGRRLVHAPAKTAGPPS
WTTSGTALVTGGTGGLGARVARWLVERGAEHLVLLSRRGPAAEGADEIRLELEAAGAQVS
VVACDVADRAALTAVLADLPDEWPLRTVVHAAGVMDDDVALAATTPERFERQLRVKADGA
RHLDELTGDQELDAFVLFSSGAAAWGSGGQAAYAAGNAYLDALAQHRRARGRTATSVAWG
SWGETGMVLGLAAAERDDLDLLGVVPMRPELAIAALQRALHQDDATVVVTDLDWSRFAPV
FTAVRPSALLSDLAEVAEALGGSQPDDASSEGPAARLAGLSEEQRRAALLDLVGESAAAV
LGHAAGTRIDEDQPFKDLGFDSLMAVELRNLLQAGTGTSLPAGLVFDYPTVSRLAAHLAG
EFGEARAAEAATVPALVSLTDDPVVLVGMACRFPGGVSGPDDLWRLVIDETDGITPFPAD
RGWNLDELLGTNALVAAGEGGFLDGVGDFDAAFFRMSPREALATDPQQRLLLETSWEALE
QAGITPSSLAGSPTGVFVGAYQTGYTELASHSGEQSQGHLIVGGAGSVISGRVAYTLGLE
GPAVSVDTACSSSLVAMHLAAQALRAGECSLALAGGVMVMPTPEAFVGFTAQGALAADGR
CKSFADAADGTGWSEGVGVVVLERLSDARRHGHEVLAVLRSSAMNQDGASNGLTAPNGPS
QQRVIRQALAAAGLSAADVDVVEAHGTGTRLGDPIEAEAVLATYGQDRPGGRPLWLGSLK
SNIGHAQAAAGVGGVIKMVLALRHGVLPKTLHVDEPSAQVDWARGDVRLLTEAVAWPETG
RPRRAGVSAFGVSGTNAHVILEAPPEEPGVPARQLSTEDGVVPWVLSGKSAEAAREQASR
LLEHFGADPSLRPVDVAWSLLGSREVFDHRTVVVGADREELLAGLRAAAAGRPAPGVVRG
VARSGGGVVFVFPGQGAQWVGMGRELLVSSPVFARSMRDCAVALEPFVEWSLEEVLGDEV
ALGRVDVVQPVLWAVMVSLAAVWRSFGVEPAAVVGHSQGEIAAACVAGGLSLADGARVVA
LRSRAIAEQLTGGGMVALPMPAGQVRDLLAEHPDVSLAAINGPTSTVVAGETGALERLLF
DCREREIQARRIAVDYASHSRLVERIEERLLTDLAPITPRPAAIPVFSSVTGEQADTASW
DARYWYRNLRSTVRFEDALTAALDAGPGTVLEVSPHTVLVPAVQDIVDGRESAVVMGTLR
RGEGGFPRTVLALAQAYAHGVRVDWATVFAGRDARRVALPTYAFQHERFWPEPATGPADV
TAAGLSSAQHPLLGATVPLPQTDGVLFTSRLSLRTHPWLADYTVRGVAVLPGTAYVELAV
RAADSVGCDRLEELVLEAPLVLPAQGGVQVQVVVGDADPGTRRRNVAVYARPDGQEEWIR
HATGQLGAGGQVLAGTTFDPVTQAWPPREATPLDTAGFYERLGDDGFGYGPVFQGLTRAW
RSGERILAEIELPEAGRGLAESFGIHPALLDAALQTSALAGLDGLQFSFTDVVLQASGAS
RVRVALTRVGPDEAALVVADSTGLPVLSIGSLIMRPLTAGGLSAGTGDGALLELRWNAVP
ATAAIPVDQWRLAAPGEPVLSALDDEPTPAAVVLPVSADPGTVADSAHQVAGRVLGRLQD
WLADERSADVPLVVVTTGAVSTGQDEPVTDPAAAAVHGLVRSAQAEYPGRIVLLDADTEL
DAAGLGLALATGEPYLALRAGQFHAARLTRVSGAAGAPPALDPAGTVVITGGTGRRGGVL
ARHLVAGYGVRHLLLVGRSGPATPEAEAAVADLAERGATVSVVACDVTDRAALGDVLASV
PPEHPVTGVVHAADVDDDFAVETLSREEFDRALASRIEGAWHLHELTRDLDLAFFVLFSS
LDGVTGTAFADWLARQRRRDGLPGLSLAWGSWASEHGLSTEQSLDLFDRALGSQDPALVL
TRLNLPALRAQAEVPAVWRSLAGITVRRAADNSRGGGEGLSRRLAGLSAVERDRLLVELV
RESAAAVLGYPSGERIGTDQPFRELGFDSVTAVDLRNTLQAGVGATLPATLVFDYPTVTR
LAAHLAEEFGDTAPAAGAVTRPVAAASVADDPVVLVGMACRYPGGVSDPDGLWRLVADGT
DGITAFPDDRGWDLETLRGTDGPGSGTSATGRGGFLDGAGEFDAAFFRISPREALATDPQ
QRLLLEVSWEALEQAGIDPTSLAGSSTGVFAGVYSSNYANLVARGGEHLQGHQITGGAAS
VISGRVAYTLGLEGPAVSVDTACSSSLVAMHLAAQALRTGECSLALAGGVTVMATADAFV
WFTAQGGLSQDGRCRSFSDSADGTGWSEGVGVVVLERMSDARRNGHEVLAVLRSSAVNQD
GASNGLTAPNGPSQQRVIRQALAAAGLSTSDVDVVEAHGTGTKLGDPIEAQAVLATYGRD
RVDGQPLWLGSLKSNIGHTQAAAGVGGVIKMVLALRHGILPKTLHVDEPSTQIDWTQGDV
RLLTAAMPWPENGRPRRAGVSSFGVSGTNAHVILEAAAGDERRGTPETPAVLTAAVPWVL
SGRTEEALRAQAARLLDFVEADPSPRPADIGWSLSGSRAVFDHRAVVPGTDRDELVTGLR
ALAAGEPGAGTVSGAAGAGARLGVLFTGQGAQRVGMARGLYGESPVFAAALDEVCAELDP
LLDRPLCEVMWGEDAELINETGWAQPALFAVEAALFEVLRAFGTTPDYLLGHSIGEVTAA
YVAGVWSLGDACRVVAARARLMQALPSGGAMAAISLPEAEMAEILPESVSVAAVNTADSV
VVSGPREAVDSVVAVVSARGAKVTRLRVSHAFHSSAMEPMLAEFAAVLETVAFRQPRIPI
VSNLTGEIASAEELCSSRYWTDQVRGTVRFADGVRLLADQGVTALVELGPDGVLSGAAHH
SCAPGTVVAPVLRREQDDASAVLSAVARLFVDGVAVDWTAVFAGRGAVRVALPTYAFQHR
RFWPDTVADVADVTSAGLSPAEHPLLGAVVPSPTDDGIVFTSRLSLRTHPWLAAHTVGGT
AVFPGTASVELAIRAGDSVGCDRVEELALETPLVLPATGVVQVQVLVGAADEDARRSFAL
YARVDGTQEWTRHATGRLGTAARAAGPDPFGPLRQAWPAPEAEEIDVTRFYEQSAEYGPM
FQGLTKAWRHGDRILAEVELPESGRDAAESFGLHPALLDAALQARVLAGREGVGSGFRDV
DLLASGAARLRVAVTPQGPDEVSLAVADRTGSPVLSIGSVTLRPLDAVGTVVDTGDRSLL
EISWVPTPGGAAPVGRWTVVGSMEPVPAAEEGAVVLRASGDSASVVESTHELTAEVLRQL
QQWPADPAGSPLIVWTRGAVTTAPGDPVTDLAAAAVWGLVRSAQTENPGRFVLLDTDPHT
DRLDATVLGEVLAAGEPQLALRGGRLFAARLTRAGAGDEPAPVLDPEGTVVVTGGTGGLG
ALAARHLVTEHGARNLLLVSRRGAAAPGAEELLAELGALGATVVASACDATDRQALAEVL
AEVPPEHPVTGVVHVAGVVDDGVLASLSREQLDRVLAPKVDAAWNLHSLTRDLSFFVAFS
SLGGLLGGGGQANYAAGNTFLDALMQQRRHHGQPGISLAWGPWSTELGMVGSLSGTDRRR
IARSATPPMSVEQGMELFDRALRADRPLLAPTRLDMAALRAQRDITPLWRSLAGSAARRV
ADNTDGGGDGLGRRLAGLSDVDRLEELADLVRESAATVLGHAPGERFDIAQPFRELGFDS
LTAVELRNLLQARTGVALAASLVFDYPTVGHVARYLAAEFGTQPAEAAVVPALASVADDP
IVLVGMACRFPGGVSGPEDLWRLVAEGTDGITPFPADRGWDLDSLLGSGGPGTGTSATGE
GGFLPEAGEFDAAFFRISPREALATDPQQRQLLEVSWEALERAGIDPSSLAGSATGVFTG
VYQTGYAELVARAEEQLQGHLLTGAAGSVMSGRVAYTFGFEGPAMSVDTACSSSLVAMHL
AAQALRSGECSLALAGGVTVMAAADMFVRFTMQGGLAADGRCRSFSDDADGTGWSEGVGV
VVMERLSDARRHGHEVLAVFRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSTSDV
DVVEAHGTGTKLGDPIEAQAVLATYGQDRPEGRPLWLGSLKSNIGHTQAAAGVGGVIKMV
MALRHGMLPKTLHVAEPSTQVDWSRGEVRLLAEAMPWPENGHPRRAGVSAFGVSGTNAHV
ILEAPAEADADETSAVGTPADETVAGEEAAEVERVVPLVLSGKSGEAVRAQAARLLEHWE
RYPSVSAVDVGWSLVSSRAVFGHRLVVAGGGREELLAGLRAVAAGEAAAGVVRGVARVGS
KAVFVFPGQGAQWVGMGRELLVSSPVFARSMRDCAVALEPFVEWSLEEVLGDEVALGRVD
VVQPVLWAVMVSLAAVWRSFGVEPAAVVGHSQGEIAAACVAGGLSLADGARVVALRSRAI
ADTLAGAGGMVALPLPVGQVRDLLAGYPDVSLAAVNGPVSVVVAGESDALGRLLAECEDR
GVRARRIAVDYASHSGLVERVEERLLTDLASIVPRSSAVPVFSSVTGGVMDTAEWDAGYW
YRNLRTTVRFEEALTAALEAGDRVVLEVSPHPVLVPAVQDIVDGREDAVTAMGTLRRDKG
SLHRMVLAVAQACVHGVAVDWTTAFPDSGARRVQLPTYAFQHQHFWPESTGGATDVGAAG
LTAAEHPLLGAMLSLPQNDEVVFTSRLSVRTHPWLADHAVRDSVIFPGTGYVELAIRAGD
SVGCDRLDELVLEAPLVLPASGGAQVQVVAGADEAERCSVAVYARVDGEETWTRHATGIV
SASAADDRADDAFEPLTQAWPAADAAPLETEQFYQQLAEGGFLRYGPVFQGLRKAWRSGD
RILAEVELPESARASAESFGIHPALLDAALHTTVFAGLDAAEQGGLPFSFTDVRLRASGA
SRLRVVLTRTGPDQVAIAVADSAGAPVLSIGSLAVRALASDSLTAGSGDGAVLLTEWLET
GPGAADPVGDWVIVAPCGADHLDLSAVGTALDEGRPVPGAVVLAVAGGPDSVVRSTHELT
GWVLRQLQYWLGEARFASIPLVVSTRGAVAVHSGEPVTDLAAAAVWGLVRSAQSENPDRI
VLLDTDTDTDTDTDKDTGIGIEAGVLGAILASGEPQWAVRGGRFHTARLVRARPVDELAA
PGDVPWRLDSTDKGMLENLVFVPAPELADPLAHGQVRVQVHAAGLNFRDVLNALDMVSDV
RAAGPLGSEVAGVVTEVGPGVSDLRPGDRIMGLAFGAFGPVAVTDHRLLARIPEGWSFAT
AASVPVVFLTAYYGLLDLAGLEPGESVVVHAGAGGVGLAAIQLARHRGAEVYATASEGKW
GVLREWGVPAERLASSRDLDFRERFRAATADRGVDVVLNSLAGEFVDASVDLLAPGGRFL
EMGKTDIRSPEDFRDRSLSYRAFDLMEAGADRIQEMLRELTALFESGGIRPLPVAAWDVR
RAPEAFRFMSQARHVGKLVLTVPQPLTPDGTVLITGAGGLGGVVARHLVAEHRVRNLVLV
SRRGSDAPGAAELTAELAGQGARVTFAACDLTDRRALAAVLGAVGPEHPLTAVVHTAGIL
EDGVIGSQSQEQLDRVLAPKVDAVWNLHELTREYDLSRFVVFSSLAGQVGNSGQGNYAAG
NVFLDSLMARRRAEGLPGQSMAWGAWTNDVGLVGTLSDTDLRRIARSAMPPLGVEQGMNL
FDRAWDSGAAVLGLARLNVRALRAQRDVAPLWRSLTGNAARRSADNTQGGRDGLARQLTG
MSTADGLAILVELVRDAAAAVLGHASSAQIDAAQPFAELGFDSLTAVELRNLLQARTGAI
LPASLVFDYPTVTHVAKHLAGAFDDTRPAGTAPLPSPVSVTDDPIVFVGMACRFPGGVAD
PDDLWQLVADGAEGITPFPADRGWDLDAALGASATGEGGFLAGVGEFDAAFFQISPREAL
ATDPQQRLLLETSWEALERAGIDPNSLAGSQTGVFTGAYHMGYSELVARGGEQLQGHQIT
GAATSVISGRVAYTLGLEGPAMSVDTACSSSLVAMHLAAQALRSGECSLALAGGVSVMAS
ADAFALFTMQGGLAADGRCRSFSDDADGTGWSEGVGVVVMERLSDARRHGHEVLAVFRSS
AVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSTSDVDVVEAHGTGTKLGDPIEAQAVLA
TYGQDRPEGRPLWLGSLKSNIGHAQAAAGVASVIKMVMALRHGVLPKTLHVAEPTTQVDW
SRGEVRLLTESVPWPDTDHPRRAGVSAFGVSGTNAHIILEAPADAGSGQGAPPAEPSGVG
DFAVDAVVPLVLSGKSGEAVRAQAARLLEHWERYPSVSAVDVGWSLVSSRAVFGHRLVVA
GGGREELLAGLRAVAAGEAAAGVVRGVARVGSKAVFVFPGQGAQWVGMGRELLVSSPVFA
RSMRDCAVALEPFVEWSLEEVLGDEVALGRVDVVQPVLWAVMVSLAAVWRSFGVEPAAVV
GHSQGEIAAACVAGGLSLADGARVVALRSRAIADTLAGAGGMVALPLPVGQVRDLLAGYP
DVSLAAVNGPVSVVVAGESDALGRLLAECEDRGVRARRIAVDYASHSGLVERVEERLLTD
LASIVPRSSAVPVFSSVTGGVMDTAEWDAGYWYRNLRTTVRFEEALTAALDVGDRVVLEV
SPHPVLVPAVQDIVDGREDAVTAMGTLRRGEGSLHRMVTAVAQASTCGLVVDWTKVFAGR
DAVRVPLPTYAFQHERYWPDPEPLAVPVVVDPADERFWASVEQQDVRSVAETLGLDSGVV
AAMVPALASWRARRRDEHAADSWRYRETWKPLGGSHFQVTSGRRLVVVPAGKSDDAWVSD
VVAVLGADTLVLEHSDDAALSGRLRAALDADVPVTAVLSLTAALEPDTTTALASTIALLR
ALRDTGAPPLWVATRGAVSVGGQDPVTAPGQGAAWGLGRVAALDQPGLWGGLIDLPEILD
TRSARLVTAVMSGTSGEDQVAVRASGLFGRRLVHAPAPRSRAGSWTTSGTALITGGTGGL
GAYVARWLVERGSDHVVLVSRHGPDAEGMKQLRLELEVAGADVTVVACDVADRAALADVL
AAIPEDRPLRTVVHAAGVVGETAPLPSMTRDQLEWPVRVKVDGARHLDELTRDLDLDAFV
LFSSGAAAWGSGGQAGYAAGNAFLDALALHRRSQGRTATSVSWGAWDQVGMLSGSGVAQR
DQLAALGVVPMRPELAITELEHAVREGETSLVVTDMDWARFAPVFTAMRPSALLSDLSEV
RAALNGSGQDAEAPGGWRGRLTGLSEADRERAVLELVRGSAAVVLGHGSGTQVPREKPFS
ELGFDSLTAVELRNLLQSESGAALPASVAFDYPTAARLAHYLSGVLELGAAVEAEVVAEP
PVLPDEDETALLAANADDLIDLALRED
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGCGTTCCGCGCACATTGAGCAGCCGATCGGCTCCGGCCCGGACCGGCTCCCGTTGCTG
CTGCCCGGAGGTCACCCCGAGTCGGTGCGCGCCCACGCCGGGCGGCTGGCCGAGTACCTG
GACGCACGGGCGGACGTGCGGCCGGCCGATGTCGGCGCGGCCTTGCGTGCGATGGCCGCC
ACCGGGCCGCACCGCGCGGCCGTCGTCGCCGCCGATCGAGCCGGCTTCGCCGACGGCTTG
CGGGCGCTGGCGGCCGGCCACGGAGCACCTGGGCTGGTCGAGGGCACCGCTCTCGGCGGG
CCGGTCGCGTTCGTGTTCCCCGGCCAGGGCGGGCAGTGGCCGGGGATGGCGAGGGACCTG
CTGGCCGAGTCCCCGGTGTTCCGGGCTCGGCTCGACGACTGCACGCAGGCACTGGAGCCC
TTCGTGGACTGGTCCCTGCTGGACGTGCTGCGCGATCCGGCCCCGCCCGGCCGCGTCGAC
GTGGTGCAGCCCGCTCTGTTCGCGATGATGGTGGCGCTCGCCGACGTGTGGCTCTCCCAC
GGGATCGAGCCCACCGCGGTAGCCGGGCACAGCCTGGGTGAGGTGGCCGCTGCCGTCGTC
GCCGACGCGCTGTCGCTGGACGACGGCGCGCGGGTGGCGGCACTGTGGAGCCGGGCCCAG
GCGACGATCGAGGGCCGGGGCGAGATGGTGTCGGTGCGCGCGCCCGAACAGCTGGTGCGC
GAGCGGCTGGCGGCCTGGCCGGACGCGCTGGTGGTGGCCGCGATCAACGGGCCGGCCACG
GTGCTGGTGTCCGGGGACACCGCAGCGGCCGCAGAGCTCGTGGCGGCCCTGACCGCCGAC
GGGATCCCGGCCCGCCGGGTGGCGACGGGACTGGCCGCGCATTCGCCGCAGATCGAGCAG
ATCCTGCCGTCGATGCGGAGGGATCTCGAGCCGATCCGGCCCCGGCCGCCGCGGCTCCCG
TTCTACTCGGCGCACCTCGGGGCCCGGCTGCCCGGGGACGCGGTGGCGCTGGACGCCGAA
TACTGGTGCGGGAACCTCCGCCACCCGGTGCGGTTCGAGGAAGCCACCAGGGCCCTGCTC
GCCGACGGCTGCCGGGTGCTCGTGGAAGTCAGCCCGCACCCGGTGCTGACCGCGGCGATG
CAGGAGACCGTGGAATCCGGGCCGGTTGCGGCGACGGTGTGCGGTTCGCTGCGCCGCGAC
CAGGGAGACCTCCGCAGGTTCCTGCTGTCACTGGGCGAGGCGTACGTGGGCGGCGCCGAG
CCCGGCGGCGATGCGCTGTACGCCGGCCACGCCCCGGTGCCGCCGGCCGACCTGCCCGTG
GCCGGGACCGGCACCGGACAGTCCTCTTCGGACCCTTCGCTGTATGGGGAGCTGGCCGGC
CTGGAGCGGGCCCGCCGACAGGCGGTGCTGACGGAGCTGGTGTGCCGCGAGGTCGCCCTC
GCCCTGGGCGTGGGTGAGGCGGACGCGGTCGATCCGGACCGACCATTCCGCGACCTGGGG
TTCGATTCGGTGACCGTGGTCGAGGTGCGCAACCGGGTGTCGGCGGCCAGCGGGCTGACG
CTGCCGGTCACGGTCACCTTCGACCACCCGACGCCCGCCGCGCTTGCCGCCGCCCTCGCC
GAGCGGCTCTTCGGTCCTGATCCCGGCGCCGGTCACGAACCGGACCGGCTCACGTCCGCC
ACCGAGGACCCGGTCGTGATCGTCGGGATGGGGTGCCGGTATCCGGGAGGCGCCCACGGC
CCCGACCGCCTGTGGGAGCTCGTCGCGAGCGGCGCCGACGCGCTGACGCCGTTCCCGGCC
AACCGGGGCTGGGACGTCACCGGGACGTACGCGCCCGAGACGGACCGGACGGGCCACCAC
TACCAGCGCGAGGCCGGGTTCGTGCACGACGCGGACCTGTTCGACGCCGACTTCTTCGGC
ATCTCGCCCCGCGAGGCCACCGTGATGGACCCCCAGCAGCGGCTGCTGCTGGAAACGTCG
TGGGAGACGTTCGAACACGCGGGCATCGACCCGACTTCGCTGCGCGGCAGCCGAACCGGC
GTGTTCATCGGCGCGATGACGCTGGAGTACGGGCCCGGCACGGGCGACGACACCGGCTTC
GGTGGGTACGTGTTCACCGGCACCACCGGCAGCGTGCACTCCGGCCGCATCGCGTACAGC
CTCGGCCTGGAGGGCCCGGCGGTCACCGTCGACACCGCCTGCTCTTCCTCGCTGGTAGCC
CTGCACCTGGCGGTGCAGGCGCTGCGGGCGGGCCAGTGCGACCTGGCCGTGGCCGGCGGC
GCCACGGTGATGCCGAACCTCGGCATGTTCGTGGAGTTCTCCCGGCAGGGCGGGCTGGCC
GGCGACGGCCGGTGCAAGGCGTTCTCGGCCGCCGCCGACGGCTTCGGTCTGGCCGAGGGC
GTGGGCCTGCTGCTGGTGGAACGGTTGTCGGACGCTCGGCGCAACGGGCACCAGGTGCTG
GCGGTGGTGCGGGGTTCGGCGGTCAACCAGGACGGGGCGTCCAACGGCCTGACGGCGCCG
AACGGCCCGTCGCAGCAGCGGGTGATCCGGCAGGCACTGGCCGACGCCGGCCTGGCACCG
TCCGACGTGGACGTGGTGGAGGCCCACGGCACCGGCACCAGGCTCGGGGACCCGATCGAG
GCCCAGACGATCCTGGCGACCTACGGACAGGACCGGGAGCGTCCGCTGTGGCTGGGCTCG
GTGAAGTCCAACCTCGGGCACACGCAGGCCGCGGCCGGGGTCGCCGGGATCATCAAGATG
GTCCAGGCGATGCGGCACGGCCTGCTGCCGAAGACCCTGCACGTCGACGAGCCCACCCCG
CACGTCGACTGGTCGGCCGGGGCCGTCCGACTGCTCACCGACCCCACCCCCTGGCCGGAC
GACGGCCGCCCGCACCGGGCCGCGGTCTCCTCCTTCGGCGTCAGCGGCACCAACGCACAC
GTGATCCTGGAGGCTCCCGAAAAAGCGGTGCCGGACGCGACGCCCGAGGCGCCGTCCGAT
TCCGTTGCGGTGCCGTGGGTGCTGTCCGGGAAGTCGGACGCGGCGGTCCGGGCGCAGGCC
GCCCGGTTGCTGGAGTTCGTCGAGGCGGACCCGGCCCTGCGCACCGTCGACGTGGGCTGG
TCGCTGGTCAGCTCCCGGTCGCTGTTCGAGCACCGGGCCGTGGTGGCGGGCTCGGGCCGG
GACGAGCTGTTGGCGGGCCTGAGGAACGCGGTGGCCGGCGAGTCCGCGCCGGGAGTGGCG
CGGGGCATCGCGCGGCCCGGCGGCGTGAAGACGGTGTTCGTCTTCCCGGGCCAGGGCGCG
CAGTGGGCCGGGATGGGCCGTGACCTGATGGCCTCGTCCCCGGTGTTCGCCGCGCGGCTG
CGGGAGTGCGCCGACGCGCTGGCCCCTTACGTCGACTGGGATCTGGCCGAGGTGGTCGGT
GGCGCCGAGGGCGCTCCCGGGTTCGAGCGGGTGGACGTGCTCCAGCCGGTGTCGTGGGCC
GTGATGGTGTCGCTCGCGGCGCTGTGGCGGTCCTTCGGCGTCGAGCCTTCCGCAGTGGTC
GGGCATTCCCAGGGCGAGCTCGCGGCCGCGGTCGTCGGCGGGTACCTCACCCTCGAGGAC
GCGGCGCGGATCGTCGCGCGGCGCAGCCGGATGATCACCGAGGAGCTGACCGGGCGCGGC
GGGATGCTGTCCGTGCTCATGGGCGTGGACTGGGTCACCGAAGCCCTGCGGCCGTGGGCG
GGCCGCCTGTGGATCGCGGCGGTCAACGGGCCGGCCTCGGTGTCGGTCTCGGGTGACGCC
GAGGCGCTGGGCGAGTTCGGCCGGGTGCTGTCGAAAGCGCGGGTCCATCGCTGGCAGTTG
CCCGGGGTGGACTTCGCCGGGCACTCCGGGCACGTCGACGCCATCGAGGAACGGCTGCGC
GCGGAGCTGGCCGACATCACCGCGCGGCCGGGCGAGGTGCCGTGGATGTCCACTGTGGAC
GGGCAGTGGGCCGACCACGCTCGTGTGGACGCCGACTACTGGTACCGCAACCTGCGCGAC
GTGGTTCGCTTCGAGGACGCGACGGAGGCGCTGATCGCGTCGGGCCACCGGGTTTTCGTC
GAGGTCTCGACACACCCGGTGCTGACCACCGCGATCGGCGAGGTGGCGGAGGCGCACCAG
GACCCGGGCATTGCGGTGGCCGGCACGTTGCGCCGCGACGACGGCGGCGCGGGCCGGTTC
GTCGCCGCGCTCGCCGAGGTGGTGGCCGCGGGGGTGGACGCCGACTGGGCCGCCGTGTTC
GCCGGCACCGGCACGAAGCGCGTGCCGCTGCCGACGTATGCCTTCCAGCGCAAGCGTTTC
TGGTTCGACACCGCCGAGGTGCCCACCGATGTCACCGCCGCGGGCCTGAGCCCGGCCGAG
CACCCGTTGCTCGGTGCGAAGGTGCCGTTGCCGCACACGGACGGCGTGCTGTTCACGAGC
CGGCTGTCGCTGCGGACGCACCCGTGGCTGGCCGGCCACACCGTGCGGGACACCGTGCTG
TTCCCCGGCACCGGCTACGTGGAGCTGGCCGTCCGGGCGGGTGACAGCGTGGGCTGTGAC
CGGTTGGACGAGCTGGCCCTGGACACTTCGCTGGTGGTGCCCGCCGAAGGGGGCGTGCGA
GTCCAGGTGGTGGTGTCGGACGCCGACGCGGACTCCCGCCGGAGCGTGGCGGTGTACGCG
TGCCCTGACGGACAAGAGGTGTGGACCCGGCACGCCACCGGCGTGCTCGGTACCGGCGCT
TCCGCGGACGCGGACGCGGACTTCGACATCGTGACCGGGGTCTGGCCGGTGCCCGGCGCG
ACCGAGGTGGATACTTCGAGCTTGTCCGACAGGCTGGACGCGGCCGGGTTCGCGTACAGC
CCCCTGTTCCAGGGCCTGACCCGGGCCTGGCGCCACGGCGACCGGATCCTGGCCGAGGCC
GGGCTTCCCGCGGACGCCGGCGCGGAGTCGTTCGGGATCCACCCCGCGCTGCTTGATTCC
GCGGTGCGGACGGGAAGCCTCACCGGAGTGGACGGGCTGCCGGCCGGCTTCACGGACGTG
GTGTTGCGGGCGTCGGGAGCGTCGAGGCTGCGGGTGGTACTGACCCGCACCGGGCCGGAC
GAGGTTTCGCTGGCTGCCGCGGACGCCGCCGGCCTTCCGGTGCTGTCGATCGGATCGCTG
ACCGTGCGCCCGCCGACCGCGCAGAGCGTGAGCACCGGTCTCGGCGACGGCGCACTGGTG
AAGCTGGACTGGCCGGGCATCGCCGCCACCGCCGCCGCGGTGGCGGACCGGCTGGTGGTC
GATCGTCCCGGTTCGATAGCGGACGCCGTGGCGGCGGGTCCGCTGCCGCCGGTGGTGGTG
TTGCCGGTGTCCGGGGACCCGGACGCGGTCGTGGAGTCCGTCCATGACGTCACAGGGTGG
GTGCTGGAGCAGGTGCAGCACTGGTTGAGCGACGAGCGGTTCGCCGCCACGCCGCTGGTC
GTGGCGACCACGGGCGCGATCGCCGTCCGGCCGGGGGACACGGTCACCGATCCGGCGGCG
GCGGCGGTGTGGGGCCTGGTGCGATCGGCGCAGACCGAGAACCCCGGCCGTTTCGTCCTC
GTCGACACCGACGCCGAGTTGGACACCGCCGTGCTGGGCCGGATCCTGGCCGCGGACGAG
CCGCAACTGGCCTTGCGCGCAGGCCGGTTGCACGCCGCTCGCCTGACCCGAGTGAGCCCG
GCCGACGGAGCGGGGCCGGCCCTGGACGGCGCCGGCACGGTCGTGATCACGGGCGGCACG
GGTGGCCTGGGTGGTCTCTTCGCCCGGCACCTGGTGACCGAGCATGGCGTCCGGCACCTG
CTGCTGCTCAGCCGGCGCGGCCCGGACGCACCCGGCGTCACCGAACTGGTGGCGGATCTG
GCGCGGCTCGGCGCCGAGACGATCGTCTCGGCGTGCGACGTGACCGACCGGCGAGCCCTG
GCCGACGCGCTGGCGTCCGTGGCCGAGGAGCACCCGGTGACGGGTGTCGTGCACGCCGCG
GCGGTGCTCGACGACGGGGTGATCGGGTCGCTGTCGCGCCGGCAGCTCGACCGGGTGCTC
GCCCCGAAGGCCGACGCGGCCTGGTACCTGCACGAACTGACCCGCGACCACGACCTGTCC
TTGTTCGCGGTCTTCTCGTCCGTCGCGGGCCTCACCGGCAACGGCGGGCAGGGCAACTAC
GCCGCGGGCAACGTTTTCCTGGACGCGCTCATGCAGCAGCGCCACGACGCGGGACTGCCG
GCTCTGTCGATGGCCTGGGGTCCGTGGACGACGGAGGTCGGCCTGGTCGGCAGTCTTTCC
GACACCGACCTGCGGCGCATCGCGCGGTCGGCCATGCCGGAGCTGCCGGTGGCGCAGGGC
CTCGCGCTGTTCGACCGGGCGCTGCGCGCCGGTGCGCCGGTGCTGGGACTGACCCGGCTG
AACATCGGGGCGCTGCGCGCCCAGGCGGACGTGCCGGCCGTGTGGCGGTCGCTGGCCGGC
GGTACCCGGCGCCGCGCGGCCGACAACACCACAGACAGCACGCGGCTGGCGGGACTGTCC
GGTGCGGAGTGCCGACGGGTGCTCGTCGATATGGTGCGCGAGGCCGCGGCGGCCGTACTG
AGGCACGACGCGGGCACGGAGATCAGCACCACACAGCCGTTCAAGGCGCTCGGGTTCGAC
TCGCTGACCTCGGTCGAGCTGCGCAACCTGCTGCGGGCGAGGACGGGGCTCGCACTGCCG
ACCGGTGTCGTGTTCGACTACCCGACCGTGGCCCGGCTGGCGGAGTACCTGTCCGGCAGG
CTCGGGCAGCCCCCCGCCGCGGAGCCGGAGGTGCGGCCGGCGGTGGTACCGGCACCCATG
GCCGACGACCCAGTCGTCCTGGTGGGGATGGCCTGCCGCTATCCGGGCGGGGTGTCCGAT
CCGGCCGGTCTGTGGCAGCTGGTCGTGGAAGAAGCCGACGCCATCACGCCGTTCCCCGCC
GACCGCGGCTGGGACCTCGCCGCGCTGCGGGGCACCGACGGGCCCGGCCTCTCCGCCACC
GAGCAAGGCGGATTCCTCGACGCGGTCGGCGATTTCGACGCGGCGTTCTTCGGTATCTCG
CCGCGGGAGGCGCTGGCCACCGATCCGCAGCAGCGGCTGCTGCTCGAGGTTTCCTGGGAG
GCGTTGGAACACGCGGGGATCGACCCCGCCGCGCTGGCGGGCAGTCAGACCGGCGTCTTC
ACCGGCGTCTACCAGTCCGGCTACGGCGATCTGCTCTCCCGTTCGGCCCAGCGCCTGCAG
GGGCATCTGCTCACGGGCAGCTTGGCCAGTGTGCTGTCCGGCCGGGTGTCCTACGTGCTG
GGCCTGGAGGGGCCGGCGGTGAGTGTGGACACGGCGTGTTCGTCGTCGTTGGTGGCGATG
CACCTGGCGGCGCAGGCGTTGCGGGCGGGGGAGTGCTCGCTCGCGCTGGCGGGCGGGGTC
ACGGTGATGGCCGGCTCCGAGGGATTCGTGGAGTTCACGGCGCAGGGAGGGCTGTCCGCC
GACGGCCGCTGCAAGTCGTTCGCCGACGCCGCCGACGGCACCGGCTGGTCCGAGGGTGTC
GGGCTCGTGGTGCTCGAGCGGTTGTCGGACGCCCGTCGCCATGGTCACGAAGTCCTGGCG
GTCCTGCGGTCGAGCGCGGTGAACCAGGACGGCGCCTCCAACGGGTTGACGGCGCCGAAC
GGTCCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTGGCGGCCGCGGGACTGTCCGCTTCG
GACATCGACGTGGTGGAGGCCCACGGCACCGGCACCCGGCTCGGCGACCCCATCGAGGCC
GAGGCGATCCTGGCCACCTACGGTCAGAACCGCCCCGGGGACCGGCCGTTGTGGCTGGGG
TCGCTGAAGTCGAACATCGGGCACACGCAGGCCGCGGCCGGCGTGGGCGGTGTGATCAAG
ATGGTCATGGCCATGCGGCACGGCGTGCTGCCCAGGACCCTGCACGTCGACGAGCCCTCG
GCGCGGATCGACTGGTCCCAGGGCGACGTGCGGCTGCTGACCGAGGCGATGCCCTGGCCG
GAGAACGGGCATCCGCGCCGGTTCGGCGTGTCCTCGTTCGGGATCAGCGGCACGAACGCG
CACGCCATCCTCGAAGCCCCCGCCGGCTCCCCGACCGAACCCGCAGCGACCGGTGCCGCG
AGCGTCCTGGCCGACGGCGTGCCGTGGGTGTTGTCCGGGAAGTCCGAGGACGCGCTGCGG
GCGCAGGCGGCTCGGTTGCTGGAGTTCGTGGAAGCGGACCCGTCGCGGAGCGCGGTGGAT
GTCGGCTGGTCGCTGGCCCATTCGCGGTCGGCGTTCGACCACCGCGTCGTGCTGGCGGGC
GCGGACCGGGACGAGCTGGTGGCCGGGCTGCGAGCGGTCGCGGTCGGTGGCCCGGCCCCG
GGAGCGGTGCGGGACACGGTCCGGCCCGAGCCCCGGGTGGGCGTGCTGTTCCCGGGTCAG
GGCGCGCAGCGGATCGGGATGGCGCGGGACCTCTACGACCGGTCCGCGGTGTTCGCGTCC
ACCGTGGACATGATTCTGGCCGAGCTGGATCCGCTGTTGGACCGGCCGTTGCGTGAGGTC
ATGTGGGGCGAGGACGCGGAGCTGGTCAACGAGACGGGCTGGGCGCAGCCGGCGTTGTTC
ACCGTGGAAGCAGCCCTGTTCGAGGTGGTGCGCGCGTTCGGGGTGACTCCGGACTACCTG
CTGGGGCATTCGATCGGGGAGATAACCGCCGCGTATGTGTCGGGCGTGTGGTCGCTGGCC
GACGCCTGCCGGGTGGTGGCGGCGCGGGCCCGTCTGATGCAGGCGTTGCCGGCGGGCGGG
GCCATGGCCGCGGTCGGGCTTTCCGAGGCCGAGGTCGCGGACCTGCTCCCCGGCGGGGTC
TCGATCGCGGCGGTGAACACCGCGGACTCGGTTGTCCTTTCCGGTCCGCGGGATGACGTC
GAGCGGGTAACGGCCGCCGCGGCCGAGCGCGGCGCCAAGGTGACGCGGTTGCGGGTGTCG
CACGCGTTCCACTCGTCCTTGATGGATCCGATGCTGGCGGAGTTCGCCGGCGTCCTGGAG
TCGGTGGAGTTCCGGCCGCCGCGGATCCCGGTGGTGTCGAACCTGACCGGCGAACCCGCC
GCCGAGGACCTGTGCTCGCCGGAGTACTGGGTCCGGCAGGTGCGCGGCACGGTCCGGTTC
GCCGACGGGGTGCGCTCGCTGGCCGAGCAGGGTGTGACGGCGTTGGTGGAGCTCGGCCCG
GACGCGGTGCTGTCGGGGCCGGCGCAGCACAGTTGTGCTCCGGGAACGGTGGTGGCGCCG
ATGTTGCGGCGCGGGCACGACGACGTGTGCACCGTGCTCTCGGCGCTCGGGCTGGTGTAC
GCGCAGGGTGTGTCCGTGGACTGGGCCGGGGTGTTCGCCGGCCGTGGCGCCGCCCGCGTT
CCGCTGCCGACCTACGCCTTCCAGCGGCAGCGGTTCTGGCCGGAGCCGTCTCCGGTCGCG
TCCCGGGCGTCCGTCGACCCGGCCGACGAGCAGCTCTGGACGTCGGTGGAGCAGCAGGAC
GTCGAGGCGCTGGCGGACGCGCTCGGCCTCGACAGCGCCGAGGCCGCTTCGGTGCTGCCG
GCACTGGCGTCGTGGCGCACGCGTCGCCGCGACGAGTCCACAACGGACGGATGGCGGTAC
CGCGAGAGCTGGAAACCGCTGGGGGCTCCCACGGCGGCGACGCCCGGCCACTGGCTGGTC
GTGGTACCGGCTGGAGCCGGTGACGACGCCGGGACCCGGGAGATCGTCGACGCCCTCGGC
GCCGGGACGCGGGTGCTCGAACACAGCGGACCCGATCGCGCGGCGCTCGCCGGGAAGCTG
AGCGACGCCGCCGGGTCGGGCGTCCCGGTGGCCGGGGTGCTGTCGCCGGCGGCGCTCGAG
CCGGACACGGCGACCGGGCTGGTGTCGGCCACCTTGCTGCTGCGGGCGTTGCGGGACACC
GGTCTGTCCGCCCGCCTGTGGGTGGTGACGCGGGGCGCCGTGTCGATCGGGTCCCATGAC
CCCGTGACCGCTCCGGGGCAGGGCGCGTTCTGGGGGTTCGGCCGGGTCGCCGCGCTGGAG
GAGCCCGAGCTGTGGGGCGGTCTGGTGGACCTGCCCGGAACGCTGGACCTTCGAACCGCC
CGCCGGTTCGCCGCCGCCGTGTCGGACACCGCGGGCGAGGACCAGATCGCGGTCCGCTCC
TCCGGCTGGTACGGCCGCCGGCTGGTGCACGCCCCGGCGAAGACCGCCGGTCCGCCGTCG
TGGACGACGTCCGGGACGGCGCTGGTCACCGGTGGCACCGGTGGCCTGGGTGCGCGGGTC
GCCCGGTGGCTGGTCGAGCGGGGCGCCGAACACCTCGTGCTGCTGAGCCGGCGTGGACCG
GCGGCCGAGGGCGCCGACGAGATCCGGCTGGAACTGGAGGCCGCGGGCGCGCAGGTGAGC
GTGGTGGCCTGCGATGTGGCCGACCGTGCCGCGCTGACCGCGGTGCTGGCGGACTTGCCG
GACGAATGGCCCTTGCGGACAGTGGTGCACGCCGCCGGGGTCATGGACGACGACGTGGCG
CTGGCGGCGACGACCCCGGAGCGGTTCGAGCGTCAGCTACGGGTGAAGGCCGACGGGGCA
CGTCATCTCGACGAGCTCACAGGTGATCAGGAACTCGACGCGTTCGTGCTGTTCTCCTCC
GGGGCGGCGGCGTGGGGCAGCGGCGGGCAGGCCGCGTACGCGGCGGGCAACGCCTACCTC
GACGCGCTCGCGCAGCACCGCCGCGCGCGGGGCCGGACGGCGACATCGGTCGCCTGGGGC
TCGTGGGGCGAGACCGGCATGGTGCTGGGCCTGGCCGCGGCCGAGCGGGACGACCTGGAC
CTGCTGGGTGTCGTGCCGATGCGGCCCGAGCTGGCGATCGCCGCGCTGCAACGCGCGCTG
CACCAGGACGACGCGACGGTCGTCGTCACCGACCTCGACTGGAGCCGGTTCGCTCCGGTG
TTCACCGCGGTCCGGCCGAGTGCCCTGCTGTCGGATCTGGCCGAGGTCGCCGAGGCACTG
GGCGGCTCGCAGCCGGACGACGCGAGTTCCGAGGGGCCGGCGGCGCGGCTGGCCGGCCTG
TCCGAGGAACAACGCCGGGCCGCTTTGCTCGACCTGGTCGGCGAATCGGCGGCGGCCGTG
CTGGGGCACGCGGCAGGCACGCGGATCGACGAGGACCAGCCGTTCAAGGACCTGGGCTTC
GACTCGCTGATGGCGGTCGAGCTGCGCAACCTGCTGCAGGCCGGCACGGGGACGAGCCTT
CCCGCCGGCCTGGTGTTCGACTACCCGACCGTGAGCCGGCTCGCGGCACACCTGGCCGGT
GAGTTCGGCGAGGCCCGCGCGGCGGAGGCGGCCACGGTGCCCGCGCTCGTTTCGCTCACC
GACGACCCCGTCGTCCTGGTCGGCATGGCGTGCCGGTTCCCGGGCGGGGTGTCGGGGCCG
GACGACCTGTGGCGGCTGGTCATCGACGAGACCGACGGCATCACCCCGTTCCCGGCCGAT
CGTGGCTGGAATCTGGACGAGTTGCTGGGGACGAACGCCCTCGTGGCGGCCGGCGAAGGC
GGATTCCTCGACGGCGTCGGCGATTTCGACGCGGCGTTCTTCCGGATGTCGCCGCGGGAG
GCGCTGGCGACCGATCCGCAGCAGCGGTTGCTGCTCGAAACCTCTTGGGAAGCGCTGGAG
CAGGCCGGGATCACGCCCTCGTCGCTGGCGGGCAGCCCCACCGGTGTGTTCGTCGGCGCG
TACCAGACCGGCTACACCGAGCTGGCGTCCCACTCCGGCGAGCAGTCGCAGGGGCATCTG
ATCGTCGGTGGCGCGGGCAGTGTGATCTCCGGCCGGGTGGCCTACACCCTTGGGCTGGAA
GGTCCGGCGGTGAGTGTGGACACGGCGTGCTCGTCGTCGTTGGTGGCGATGCACCTGGCC
GCACAGGCGTTGCGGGCGGGAGAGTGCTCGCTGGCGCTGGCGGGCGGGGTCATGGTGATG
CCCACGCCCGAAGCGTTCGTCGGCTTCACCGCGCAGGGTGCACTGGCGGCGGACGGTCGT
TGCAAGTCGTTCGCGGACGCGGCCGACGGGACCGGCTGGTCCGAGGGTGTCGGTGTGGTG
GTGCTGGAGCGGTTGTCGGATGCTCGTCGGCACGGCCATGAGGTGCTGGCGGTGCTGCGG
TCGAGTGCGATGAATCAGGACGGTGCGTCGAATGGGCTGACGGCGCCGAACGGTCCGTCT
CAGCAGCGCGTGATCCGCCAGGCGCTGGCCGCCGCGGGTCTGTCCGCTGCGGACGTCGAT
GTGGTCGAGGCGCACGGCACCGGGACGCGGCTGGGTGATCCGATCGAGGCGGAGGCGGTG
CTGGCGACCTATGGTCAGGACCGGCCAGGGGGTCGGCCGTTGTGGCTGGGGTCGTTGAAG
TCGAACATCGGGCACGCGCAGGCGGCGGCCGGTGTCGGTGGTGTGATCAAGATGGTGCTG
GCGTTGCGGCACGGGGTGCTGCCGAAGACGCTGCACGTGGACGAACCGTCGGCCCAGGTG
GACTGGGCGCGAGGCGACGTTCGGTTGCTGACCGAGGCTGTCGCGTGGCCGGAGACCGGC
CGCCCGCGCCGGGCCGGCGTGTCCGCGTTCGGGGTCAGTGGCACCAATGCGCACGTGATT
CTCGAAGCCCCGCCCGAAGAGCCCGGCGTCCCGGCGCGACAGTTGTCCACTGAGGACGGT
GTCGTGCCGTGGGTGCTGTCCGGGAAGTCGGCCGAGGCCGCCCGGGAGCAGGCGTCCCGG
TTGCTGGAGCACTTCGGCGCCGATCCGTCGCTGCGTCCCGTCGACGTGGCGTGGTCGTTG
CTCGGCTCGCGAGAGGTGTTCGACCACCGGACGGTGGTCGTGGGCGCCGACCGGGAGGAG
CTGCTGGCCGGTCTGCGCGCGGCGGCTGCCGGCCGGCCTGCGCCGGGCGTGGTCCGTGGC
GTCGCCCGCTCCGGCGGTGGCGTGGTGTTCGTGTTCCCGGGTCAGGGTGCGCAGTGGGTG
GGGATGGGGCGGGAGTTGTTGGTTTCGTCGCCGGTGTTCGCGCGGTCGATGCGTGATTGT
GCGGTGGCGTTGGAGCCGTTTGTGGAGTGGTCGTTGGAGGAGGTGCTGGGTGATGAGGTG
GCGTTGGGGCGGGTGGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCGTTGGCT
GCGGTGTGGCGGTCGTTCGGTGTGGAGCCGGCCGCGGTGGTGGGGCATTCGCAGGGGGAG
ATCGCGGCGGCGTGTGTGGCTGGTGGTCTGTCGTTGGCGGATGGGGCGCGGGTGGTGGCG
TTGCGCAGCCGCGCGATAGCCGAGCAGCTCACCGGTGGCGGGATGGTCGCGCTGCCGATG
CCGGCCGGACAGGTGCGCGATCTGCTCGCGGAGCACCCGGACGTGTCGCTGGCCGCGATC
AACGGGCCGACGTCGACCGTCGTCGCGGGCGAGACCGGCGCTCTGGAGCGGCTGCTGTTC
GACTGCCGTGAGCGGGAGATCCAGGCGCGCAGGATCGCCGTGGACTATGCGTCGCACTCG
CGGCTGGTGGAGCGGATCGAGGAGCGGCTGCTGACCGACCTGGCGCCGATCACGCCGCGG
CCCGCGGCGATCCCGGTCTTTTCGTCCGTGACGGGGGAGCAGGCGGACACCGCGTCGTGG
GACGCGCGGTACTGGTACCGCAATCTGCGGAGCACGGTGCGGTTCGAGGACGCGCTCACG
GCCGCCCTCGACGCGGGACCGGGCACGGTGCTCGAAGTCAGCCCGCACACGGTGTTGGTG
CCCGCCGTCCAGGACATTGTGGACGGTCGCGAAAGCGCCGTCGTGATGGGCACCCTGCGC
CGCGGTGAAGGTGGTTTCCCCCGGACGGTGCTGGCGCTCGCGCAGGCGTACGCGCACGGC
GTCCGCGTGGACTGGGCGACGGTGTTCGCCGGTCGCGACGCCAGGCGCGTCGCGTTGCCG
ACGTATGCGTTCCAGCACGAACGCTTCTGGCCCGAGCCGGCCACCGGGCCCGCCGACGTG
ACCGCGGCCGGTCTGAGCTCCGCGCAGCATCCGTTGCTGGGTGCGACGGTGCCGCTGCCG
CAGACGGACGGCGTGCTGTTCACCAGCCGCCTGTCCCTGCGCACCCATCCCTGGCTCGCC
GACTACACAGTGCGCGGCGTCGCGGTGCTGCCCGGGACCGCGTACGTCGAGCTGGCTGTC
CGCGCCGCCGACAGCGTGGGCTGCGACCGGCTCGAGGAACTGGTCCTGGAGGCGCCGCTG
GTGCTGCCCGCCCAGGGCGGCGTGCAGGTGCAGGTCGTGGTCGGCGACGCCGATCCCGGG
ACACGGCGGCGGAACGTGGCCGTGTACGCGCGTCCCGACGGGCAGGAGGAGTGGATCCGG
CACGCCACCGGCCAGTTGGGCGCCGGCGGCCAGGTTCTCGCCGGGACGACGTTCGACCCG
GTTACCCAGGCCTGGCCGCCGCGCGAGGCGACGCCGCTCGACACCGCGGGCTTCTACGAG
CGGCTCGGTGACGACGGGTTCGGCTACGGCCCGGTGTTCCAGGGGCTGACCCGGGCGTGG
CGATCCGGCGAGCGGATCCTCGCCGAGATCGAGCTGCCCGAGGCCGGCCGTGGCCTGGCG
GAGTCGTTCGGCATCCACCCCGCGTTGCTGGACGCCGCGCTGCAGACCTCGGCGCTCGCC
GGGCTGGACGGGCTTCAGTTCAGCTTCACCGACGTGGTGCTCCAGGCGTCCGGCGCGTCC
CGGGTGCGGGTCGCGCTCACCCGTGTCGGCCCGGACGAGGCCGCCCTCGTGGTCGCGGAC
TCGACCGGACTTCCCGTGCTGTCGATCGGCTCCTTGATCATGCGGCCGTTGACGGCCGGC
GGTCTGAGCGCGGGCACCGGCGACGGCGCGCTGCTCGAACTGCGGTGGAACGCCGTGCCC
GCGACCGCCGCGATCCCCGTGGACCAGTGGCGTCTGGCCGCGCCCGGTGAACCGGTGCTC
TCGGCACTCGACGACGAGCCGACGCCTGCCGCGGTAGTGCTGCCGGTGTCCGCAGACCCG
GGCACGGTGGCGGACTCCGCGCACCAGGTCGCGGGCCGGGTGCTGGGCCGGCTACAGGAC
TGGCTGGCCGACGAGCGCTCGGCGGATGTTCCGTTGGTCGTGGTGACGACCGGGGCTGTG
AGCACCGGCCAGGACGAACCGGTGACCGATCCGGCCGCCGCCGCGGTGCACGGTCTGGTG
CGCTCGGCGCAGGCCGAGTACCCGGGCCGGATCGTCCTGCTCGACGCCGACACCGAGCTG
GACGCCGCCGGACTGGGCCTGGCGCTGGCCACCGGTGAGCCGTACCTCGCCCTGCGCGCC
GGGCAGTTCCACGCCGCCCGGCTGACCCGGGTCAGCGGTGCCGCCGGAGCCCCGCCGGCG
CTGGATCCCGCGGGGACGGTGGTGATCACGGGCGGCACCGGCCGCCGCGGTGGTGTTCTC
GCCCGGCACCTCGTCGCCGGGTACGGGGTCCGGCACTTGCTGCTGGTCGGCCGGAGCGGC
CCTGCCACGCCCGAGGCCGAGGCAGCTGTCGCGGACCTGGCGGAGCGTGGCGCCACCGTG
TCGGTCGTGGCGTGCGACGTGACCGATCGGGCGGCGCTGGGCGACGTGCTCGCGTCCGTG
CCGCCGGAGCACCCGGTGACCGGTGTCGTGCACGCCGCGGACGTGGACGACGACTTCGCG
GTGGAGACGCTGTCCCGTGAGGAGTTCGACAGGGCGCTGGCGTCGCGGATCGAGGGCGCC
TGGCATCTGCACGAGCTGACCCGGGACCTCGATCTCGCGTTCTTCGTGCTGTTCTCGTCG
CTCGACGGAGTCACCGGGACCGCGTTCGCCGACTGGCTGGCGCGGCAGCGCCGCCGGGAC
GGGCTCCCCGGTCTGTCGCTGGCCTGGGGTTCCTGGGCTTCCGAGCACGGGTTGTCGACG
GAGCAGAGCTTGGACCTGTTCGACCGGGCGCTGGGCTCGCAGGATCCGGCGCTCGTGCTG
ACCCGGCTGAACCTGCCGGCGCTGCGGGCCCAGGCCGAGGTGCCCGCGGTGTGGCGCTCG
CTCGCGGGCATCACCGTCCGGCGTGCGGCCGACAACTCGCGCGGTGGCGGGGAAGGACTG
TCACGGCGGCTCGCCGGACTGTCCGCCGTGGAGCGTGATCGCCTGCTGGTGGAGCTGGTG
CGCGAGTCGGCCGCGGCGGTGCTCGGCTACCCGTCGGGTGAGCGGATCGGCACGGACCAG
CCGTTCCGCGAGCTGGGTTTCGACTCCGTGACGGCGGTCGACCTGCGCAACACGTTGCAG
GCCGGCGTCGGCGCCACCCTGCCGGCGACCCTGGTGTTCGACTACCCGACCGTCACCCGC
CTCGCCGCGCATCTGGCCGAGGAGTTCGGGGACACGGCCCCGGCGGCCGGCGCCGTGACG
CGGCCTGTGGCGGCGGCCTCGGTGGCCGATGATCCGGTCGTGCTGGTAGGCATGGCCTGC
CGGTACCCCGGCGGAGTGTCCGATCCGGACGGTCTCTGGCGGCTCGTGGCCGACGGGACC
GACGGCATCACCGCGTTCCCCGACGATCGTGGCTGGGACCTGGAGACACTGCGGGGCACC
GACGGGCCCGGCTCCGGGACCTCGGCCACCGGCCGCGGTGGTTTCCTCGACGGGGCCGGT
GAGTTCGACGCGGCGTTCTTCCGGATCTCGCCGCGGGAGGCGCTGGCGACCGATCCGCAG
CAGCGGCTGCTGCTGGAGGTGTCGTGGGAGGCGCTGGAGCAGGCGGGAATCGATCCGACC
TCGCTGGCGGGCAGCTCGACCGGGGTGTTCGCGGGCGTCTACTCCTCGAACTACGCCAAC
CTGGTCGCCCGCGGTGGTGAGCACCTGCAGGGGCACCAGATCACGGGTGGGGCGGCCAGT
GTGATCTCCGGCCGGGTGGCCTACACGCTGGGGCTGGAAGGCCCCGCGGTGAGTGTGGAC
ACCGCGTGCTCGTCGTCGCTCGTCGCGATGCACCTGGCCGCGCAAGCCCTGCGCACAGGT
GAGTGTTCGCTTGCGCTGGCCGGCGGTGTCACGGTGATGGCCACCGCCGACGCGTTCGTC
TGGTTCACCGCGCAGGGCGGACTGTCGCAGGACGGCCGGTGCCGGTCCTTCTCCGACTCG
GCCGACGGTACCGGGTGGTCCGAGGGTGTCGGCGTGGTCGTGCTGGAGCGGATGTCGGAC
GCGCGCCGCAACGGTCACGAGGTGCTGGCGGTGCTGCGGTCGAGTGCGGTGAATCAGGAC
GGTGCGTCGAACGGTTTGACGGCGCCGAACGGTCCGTCGCAGCAACGCGTGATCCGCCAG
GCGTTGGCGGCGGCCGGTCTGTCCACATCGGACGTGGACGTGGTCGAGGCGCACGGCACC
GGGACGAAGCTCGGTGATCCGATCGAGGCGCAGGCGGTACTGGCGACCTACGGCCGGGAC
CGCGTGGACGGGCAGCCGCTGTGGCTGGGCTCGTTGAAGTCGAACATCGGGCACACCCAG
GCCGCAGCGGGAGTGGGCGGTGTGATCAAGATGGTGCTCGCGTTGCGCCACGGGATTCTG
CCCAAGACCCTCCACGTGGACGAGCCCTCGACGCAGATCGACTGGACGCAGGGCGACGTA
CGGCTGCTGACCGCGGCGATGCCGTGGCCGGAGAACGGTCGTCCGCGCCGGGCCGGGGTG
TCGTCGTTCGGCGTCAGCGGGACGAACGCCCACGTGATCCTTGAGGCGGCAGCCGGCGAC
GAGCGTCGTGGTACCCCGGAAACTCCCGCTGTGCTCACGGCCGCGGTGCCGTGGGTGCTG
TCGGGCCGGACGGAGGAGGCCCTGCGGGCACAGGCCGCGCGGCTGCTGGACTTCGTGGAG
GCGGACCCGTCGCCGCGACCGGCCGACATCGGGTGGTCGCTGTCCGGTTCCCGCGCGGTG
TTCGACCACCGCGCCGTGGTGCCGGGAACGGATCGGGACGAGCTCGTCACCGGGTTGCGT
GCGCTCGCGGCCGGTGAGCCCGGTGCCGGGACCGTCTCGGGTGCCGCGGGGGCCGGCGCA
CGGCTCGGGGTGTTGTTCACGGGGCAGGGTGCGCAGCGGGTCGGGATGGCGCGTGGGCTC
TATGGGGAGTCGCCGGTGTTCGCGGCGGCGTTGGACGAGGTCTGTGCGGAGCTGGATCCG
TTGTTGGACCGGCCGTTGTGTGAGGTGATGTGGGGCGAGGACGCGGAGCTGATCAACGAG
ACGGGGTGGGCGCAGCCGGCGTTGTTCGCGGTCGAGGCGGCGTTGTTCGAGGTGCTGCGC
GCGTTCGGGACGACCCCGGACTATCTGCTGGGACATTCGATCGGTGAGGTCACGGCGGCC
TACGTCGCCGGGGTGTGGTCGCTGGGTGACGCGTGCCGGGTGGTGGCCGCGCGGGCCCGG
CTGATGCAGGCGCTCCCTTCGGGCGGCGCGATGGCCGCGATTTCGCTGCCCGAGGCCGAA
ATGGCTGAGATCCTGCCGGAGAGCGTGTCGGTCGCGGCCGTGAACACGGCGGACTCGGTG
GTGGTCTCGGGGCCGCGAGAAGCCGTGGACTCAGTCGTCGCGGTCGTGTCCGCTCGTGGT
GCCAAGGTGACGCGGTTGCGGGTGTCGCACGCTTTCCACTCGTCGGCGATGGAGCCGATG
CTGGCGGAGTTCGCCGCGGTTCTGGAGACGGTCGCGTTCCGGCAGCCGCGGATCCCGATC
GTGTCGAACCTGACCGGTGAGATCGCGTCCGCGGAAGAGCTGTGCTCCTCGCGGTACTGG
ACGGACCAGGTCCGCGGCACGGTGCGATTCGCCGACGGTGTGCGCCTGCTCGCCGATCAG
GGCGTGACCGCGCTGGTGGAACTGGGGCCTGACGGTGTGCTTTCCGGCGCGGCGCACCAC
AGTTGTGCGCCGGGCACGGTCGTGGCGCCGGTGTTGCGCCGCGAGCAGGACGACGCGTCG
GCGGTGCTGTCCGCGGTGGCGCGGCTGTTCGTGGACGGTGTGGCGGTGGACTGGACCGCG
GTGTTCGCGGGCCGGGGCGCGGTGCGGGTGGCGCTGCCGACCTACGCGTTCCAGCACCGG
CGCTTCTGGCCCGACACGGTCGCCGACGTCGCCGACGTGACCTCGGCCGGGTTGAGCCCG
GCGGAGCACCCGCTGCTCGGCGCCGTGGTGCCTTCGCCCACGGACGACGGGATCGTGTTC
ACCAGTCGGCTTTCGCTGCGCACGCACCCGTGGCTGGCAGCCCACACCGTGGGCGGCACC
GCGGTCTTCCCGGGCACCGCCAGTGTCGAGCTGGCCATCCGCGCCGGCGACAGCGTGGGC
TGCGACCGGGTCGAGGAACTGGCGCTGGAGACGCCGCTGGTGTTGCCGGCCACGGGAGTC
GTCCAGGTTCAGGTCCTGGTCGGTGCGGCCGACGAGGACGCGCGGCGGAGCTTCGCCCTG
TACGCGCGGGTGGACGGCACGCAGGAGTGGACCCGCCACGCCACCGGTCGGCTGGGCACG
GCCGCCCGCGCGGCCGGTCCGGACCCGTTCGGCCCGCTGCGCCAGGCCTGGCCCGCGCCG
GAAGCCGAGGAAATCGACGTGACCCGGTTCTACGAGCAGTCCGCCGAGTACGGCCCGATG
TTCCAGGGGCTGACGAAGGCGTGGCGCCACGGCGACCGGATCCTCGCGGAGGTCGAGCTG
CCCGAGTCCGGCCGTGATGCGGCGGAGTCGTTCGGGCTCCACCCCGCGCTGCTGGACGCG
GCACTGCAGGCAAGGGTGCTCGCGGGCAGGGAAGGCGTGGGGTCCGGGTTCCGCGACGTG
GATCTGCTCGCTTCCGGTGCGGCCCGGCTCCGGGTCGCAGTGACTCCGCAGGGGCCGGAC
GAGGTGTCGCTCGCGGTCGCCGACCGGACCGGCTCACCCGTGCTGTCGATCGGTTCCGTG
ACGCTGCGACCGCTCGACGCGGTCGGCACCGTGGTGGACACCGGGGACCGTTCGTTGCTC
GAGATCAGCTGGGTGCCGACTCCTGGCGGTGCCGCCCCGGTGGGTCGCTGGACCGTCGTC
GGGTCCATGGAACCCGTGCCCGCTGCCGAGGAGGGCGCGGTGGTGCTGCGGGCGTCCGGG
GACTCGGCCTCGGTGGTGGAAAGCACGCACGAGCTGACCGCCGAGGTTCTCCGGCAGCTG
CAGCAGTGGCCGGCGGATCCCGCGGGCTCGCCGCTGATCGTGTGGACCCGGGGCGCGGTC
ACCACCGCACCCGGTGACCCGGTCACGGATCTGGCCGCGGCGGCCGTGTGGGGCCTGGTC
CGGTCGGCGCAGACGGAGAACCCGGGCCGGTTCGTACTGCTCGACACCGACCCCCACACC
GACCGGCTCGACGCGACGGTGCTCGGCGAAGTACTGGCCGCGGGTGAGCCACAACTGGCG
CTGCGCGGCGGCCGGCTCTTCGCGGCGCGCCTGACCCGGGCCGGCGCGGGTGACGAACCG
GCGCCGGTGCTGGATCCCGAGGGCACGGTCGTCGTCACCGGCGGCACCGGTGGGCTGGGC
GCGCTGGCAGCGCGGCATCTGGTGACCGAGCACGGCGCGCGGAACCTCCTGCTGGTCAGC
CGGCGCGGTGCGGCTGCCCCGGGTGCGGAGGAGCTGCTGGCGGAGCTCGGGGCGCTCGGC
GCCACGGTGGTGGCGTCGGCCTGTGACGCGACCGACCGGCAGGCGCTCGCCGAGGTGCTC
GCCGAGGTGCCGCCGGAGCACCCCGTGACCGGGGTCGTGCACGTCGCGGGTGTGGTCGAC
GACGGTGTGCTCGCGTCGCTGTCGCGCGAGCAGCTGGACCGGGTGCTCGCCCCGAAGGTG
GACGCGGCCTGGAACCTGCACTCGCTCACCCGGGACCTGTCGTTCTTCGTGGCTTTCTCG
TCGCTCGGCGGCCTGCTGGGCGGCGGTGGCCAGGCCAACTACGCCGCGGGCAACACGTTC
CTCGACGCGCTGATGCAGCAGCGCCGCCACCACGGGCAGCCGGGCATTTCGCTGGCCTGG
GGGCCATGGTCGACGGAGCTCGGCATGGTGGGTTCCCTGTCCGGCACCGACCGGCGGCGG
ATTGCGCGCTCGGCCACCCCGCCGATGTCGGTGGAGCAGGGCATGGAGCTGTTCGACCGG
GCGTTGCGCGCGGACCGTCCGCTGCTGGCGCCGACCCGGCTGGACATGGCTGCGCTGCGG
GCCCAGCGGGACATCACGCCGCTGTGGCGTTCCCTGGCCGGGTCCGCGGCGCGGCGCGTC
GCGGACAACACCGACGGCGGCGGGGACGGCCTGGGCCGACGGCTGGCCGGACTGTCCGAT
GTGGACCGGCTGGAGGAGCTGGCCGACCTGGTCCGCGAGTCCGCCGCGACGGTGCTGGGG
CATGCCCCGGGCGAGCGGTTCGACATCGCTCAGCCGTTCCGCGAGCTGGGCTTCGACTCG
CTGACCGCGGTCGAGCTGCGCAATCTGCTGCAGGCCAGGACCGGCGTCGCCCTGGCGGCC
AGCCTGGTGTTCGACTACCCGACCGTCGGCCACGTGGCGAGGTACCTGGCAGCCGAGTTC
GGCACGCAACCGGCCGAGGCTGCCGTGGTGCCGGCTCTCGCGTCCGTCGCCGACGATCCG
ATCGTGCTGGTGGGCATGGCGTGCCGGTTCCCGGGCGGCGTCTCGGGCCCGGAGGACCTG
TGGCGGCTGGTCGCCGAGGGGACCGATGGGATCACGCCGTTCCCGGCCGACCGCGGCTGG
GATCTGGACTCGCTGCTGGGCAGCGGCGGCCCGGGCACCGGGACGTCCGCGACCGGCGAG
GGCGGCTTTCTTCCAGAGGCCGGCGAGTTCGACGCGGCGTTCTTCCGGATCTCCCCGCGT
GAGGCGCTGGCCACCGACCCGCAGCAGCGGCAGTTGCTGGAGGTGTCGTGGGAGGCCTTG
GAACGCGCGGGCATCGACCCGAGTTCGCTGGCCGGCAGTGCGACCGGTGTGTTCACGGGC
GTCTACCAGACCGGCTACGCCGAACTGGTCGCGCGAGCCGAAGAGCAACTGCAAGGCCAT
CTGCTCACCGGCGCGGCCGGGAGCGTGATGTCGGGGCGCGTGGCGTACACGTTCGGCTTC
GAAGGCCCGGCGATGAGTGTGGATACGGCGTGTTCGTCGTCATTGGTGGCGATGCACCTG
GCGGCGCAGGCGCTGCGGTCGGGCGAGTGTTCGCTCGCTCTCGCGGGCGGTGTCACAGTG
ATGGCCGCGGCGGACATGTTCGTCCGGTTCACGATGCAGGGTGGTCTGGCTGCGGACGGC
CGGTGCCGGTCGTTCTCGGATGATGCCGATGGGACTGGGTGGTCCGAGGGTGTCGGCGTG
GTGGTGATGGAGCGGTTGTCGGATGCTCGTCGGCACGGTCATGAGGTGCTGGCGGTTTTC
CGGTCGAGTGCGGTGAATCAGGACGGTGCGTCGAACGGTCTGACGGCGCCGAACGGGCCG
TCGCAGCAGCGCGTGATCCGCCAGGCGTTGGCGGCGGCCGGTCTGTCCACTTCGGACGTC
GATGTGGTCGAGGCGCACGGCACCGGGACGAAGCTCGGTGATCCGATCGAGGCGCAGGCG
GTGCTGGCGACCTATGGTCAGGACCGGCCCGAGGGCCGGCCGTTGTGGCTGGGGTCGTTG
AAGTCGAACATCGGCCACACGCAGGCCGCGGCCGGTGTCGGTGGTGTGATCAAGATGGTC
ATGGCATTGCGGCACGGGATGCTGCCGAAAACCTTGCACGTGGCCGAGCCGTCGACGCAG
GTCGACTGGTCCCGGGGCGAGGTGCGGCTGCTCGCCGAGGCGATGCCGTGGCCGGAGAAC
GGGCACCCGCGCCGGGCCGGGGTGTCGGCGTTCGGCGTGAGCGGGACCAACGCGCACGTG
ATCCTTGAGGCTCCTGCCGAAGCCGACGCGGACGAAACCTCGGCTGTCGGAACCCCGGCT
GACGAAACCGTGGCCGGGGAGGAAGCAGCCGAGGTCGAGCGTGTGGTGCCGTTGGTGCTC
TCGGGTAAGTCGGGTGAGGCGGTGCGGGCTCAGGCGGCTCGGTTGCTGGAGCACTGGGAG
CGGTACCCGTCGGTGAGTGCGGTGGATGTGGGCTGGTCGTTGGTGAGTTCGCGGGCGGTG
TTCGGGCATCGGCTGGTGGTGGCGGGAGGGGGTCGGGAGGAGTTGCTGGCCGGTCTGCGT
GCGGTGGCTGCGGGTGAGGCGGCTGCGGGCGTGGTGCGGGGTGTGGCGCGGGTGGGGAGC
AAGGCGGTGTTCGTGTTCCCGGGTCAGGGTGCGCAGTGGGTGGGGATGGGGCGGGAGTTG
TTGGTTTCGTCGCCGGTGTTCGCGCGGTCGATGCGTGATTGTGCGGTGGCGTTGGAGCCG
TTTGTGGAGTGGTCGTTGGAGGAGGTGCTGGGTGATGAGGTGGCGTTGGGGCGGGTGGAT
GTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCGTTGGCTGCGGTGTGGCGGTCGTTC
GGTGTGGAGCCGGCCGCGGTGGTGGGGCATTCGCAGGGGGAGATCGCGGCGGCGTGTGTG
GCTGGTGGTCTGTCGTTGGCGGATGGGGCGCGGGTGGTGGCGTTGCGCAGCCGGGCGATC
GCGGACACTCTTGCCGGTGCTGGTGGGATGGTGGCTTTGCCGCTGCCTGTCGGTCAGGTG
CGTGATCTGCTTGCGGGGTACCCGGATGTGTCGCTGGCGGCGGTCAATGGGCCGGTGTCG
GTGGTGGTCGCGGGTGAGTCGGACGCGTTGGGTCGTTTGCTTGCCGAGTGTGAGGACCGG
GGTGTCAGGGCGCGGCGGATCGCGGTGGACTACGCGTCGCATTCGGGTCTGGTGGAGCGG
GTCGAGGAGCGGTTGTTGACGGATTTGGCGTCGATCGTTCCGCGGTCGTCGGCTGTTCCG
GTGTTCTCTTCGGTGACCGGTGGCGTGATGGACACCGCGGAGTGGGATGCCGGGTACTGG
TACCGGAACCTGCGGACGACGGTGCGGTTCGAGGAGGCGCTCACGGCCGCGCTGGAGGCC
GGTGACCGCGTCGTGCTGGAGGTGAGCCCGCATCCGGTCCTGGTGCCCGCGGTGCAGGAC
ATCGTCGACGGCCGCGAGGACGCGGTGACGGCGATGGGCACGCTGCGGCGCGACAAAGGC
TCGCTGCACCGCATGGTGCTCGCGGTCGCGCAGGCCTGTGTCCATGGCGTGGCCGTGGAC
TGGACGACCGCGTTCCCGGACTCCGGCGCGCGGCGCGTCCAGCTCCCGACCTATGCCTTC
CAGCATCAGCACTTCTGGCCGGAGAGCACCGGCGGGGCGACCGACGTCGGCGCCGCCGGG
CTCACGGCGGCGGAGCACCCGTTGCTGGGGGCGATGCTGTCGTTGCCGCAGAACGACGAG
GTGGTCTTCACCAGCAGGCTGTCGGTGCGGACGCATCCGTGGCTGGCGGACCACGCCGTG
CGCGATTCGGTGATCTTCCCCGGCACCGGGTACGTGGAGCTGGCGATCCGCGCGGGAGAC
AGCGTCGGCTGCGACCGGCTCGACGAGCTCGTCCTGGAGGCGCCGCTCGTGCTCCCCGCT
TCAGGCGGCGCGCAGGTGCAGGTGGTGGCCGGGGCGGACGAGGCTGAACGGTGCAGCGTC
GCGGTGTATGCGCGGGTGGACGGTGAGGAGACCTGGACTCGCCACGCGACCGGCATCGTG
AGCGCGTCCGCCGCCGACGACCGTGCCGACGACGCGTTCGAACCTCTTACCCAGGCATGG
CCCGCTGCGGATGCGGCACCGCTGGAGACCGAGCAGTTCTACCAGCAGCTGGCCGAAGGC
GGCTTCCTCCGCTACGGCCCGGTGTTCCAGGGGCTGCGCAAGGCATGGCGGAGCGGGGAC
CGGATCCTTGCCGAGGTCGAGCTGCCGGAGTCCGCCCGCGCTTCGGCGGAGTCGTTCGGC
ATCCATCCGGCGCTGCTGGACGCGGCACTGCACACCACGGTCTTCGCCGGTCTCGACGCG
GCCGAGCAGGGCGGGCTGCCGTTCAGCTTCACCGACGTGCGGCTGCGCGCCTCGGGTGCG
TCGCGGCTGCGGGTCGTGCTCACCCGGACCGGCCCGGATCAGGTCGCCATCGCGGTCGCG
GACAGCGCCGGCGCTCCCGTGCTGTCGATCGGGTCGCTGGCCGTGCGGGCGCTCGCCTCG
GACAGCTTGACGGCCGGCTCCGGCGATGGGGCCGTGTTGCTGACGGAGTGGCTCGAGACC
GGGCCCGGCGCAGCCGACCCGGTGGGTGACTGGGTCATAGTCGCCCCCTGTGGCGCGGAC
CACCTTGACCTGAGCGCGGTCGGTACCGCGCTCGACGAGGGCAGGCCGGTGCCGGGAGCG
GTCGTGCTGGCCGTGGCCGGCGGGCCGGACTCGGTGGTCCGGTCCACGCACGAGCTCACC
GGCTGGGTGCTGCGGCAGCTGCAGTACTGGCTTGGTGAGGCGAGGTTCGCGTCGATCCCG
CTGGTGGTGTCGACCCGGGGCGCGGTGGCCGTGCACTCGGGCGAGCCGGTGACCGACCTG
GCCGCGGCCGCGGTGTGGGGTCTCGTGCGGTCGGCGCAGTCGGAGAACCCGGACCGGATC
GTGCTGCTCGACACCGACACCGACACCGACACCGACACCGACAAGGACACCGGCATCGGG
ATCGAGGCCGGTGTGCTGGGCGCGATCCTGGCGTCCGGCGAGCCGCAGTGGGCGGTGCGC
GGCGGGCGGTTCCACACCGCACGGCTCGTCCGGGCCCGGCCGGTCGACGAACTGGCCGCA
CCGGGAGACGTGCCCTGGCGGTTGGACTCCACGGACAAGGGCATGCTCGAGAACTTGGTG
TTCGTGCCGGCTCCCGAACTGGCCGATCCGCTTGCACACGGGCAGGTTCGCGTCCAGGTC
CACGCGGCGGGCCTCAACTTCCGTGATGTGCTCAACGCGCTCGACATGGTCAGCGACGTG
CGCGCGGCGGGCCCGCTGGGCAGCGAGGTCGCGGGTGTCGTCACGGAGGTCGGCCCCGGT
GTGTCCGATCTGCGGCCTGGCGACCGGATCATGGGCCTGGCGTTCGGCGCGTTCGGTCCG
GTGGCGGTGACCGACCACCGGCTGCTGGCGAGGATCCCCGAGGGCTGGTCGTTCGCCACC
GCGGCGTCGGTTCCTGTCGTGTTCCTGACCGCCTACTACGGGCTGCTGGATCTCGCCGGG
CTGGAGCCCGGTGAGTCGGTGGTGGTCCATGCCGGCGCCGGCGGCGTCGGGCTCGCGGCG
ATTCAGCTGGCACGCCACCGGGGCGCGGAGGTCTACGCCACGGCGAGTGAGGGCAAGTGG
GGTGTCCTGCGGGAGTGGGGAGTCCCGGCCGAGCGGCTGGCGTCGTCCCGGGATCTCGAC
TTCCGTGAGCGTTTCCGGGCCGCCACCGCGGATCGGGGTGTGGACGTGGTCCTGAACTCG
CTCGCGGGGGAGTTCGTGGACGCGTCGGTGGATCTGCTGGCTCCGGGCGGGCGGTTCCTG
GAGATGGGCAAGACCGACATCCGATCGCCGGAGGACTTCCGTGACCGGTCGTTGAGCTAC
CGGGCCTTCGACCTGATGGAGGCCGGCGCCGATCGGATCCAGGAGATGCTGCGGGAGCTG
ACGGCGCTGTTCGAATCCGGCGGGATCCGGCCGCTGCCGGTGGCGGCGTGGGATGTGCGC
CGGGCACCGGAAGCGTTCCGGTTCATGAGCCAGGCCAGGCACGTCGGCAAGCTGGTGCTG
ACGGTCCCGCAGCCCTTGACACCCGACGGCACCGTGCTGATCACCGGTGCCGGTGGTCTC
GGCGGCGTGGTGGCGCGGCATCTGGTGGCCGAGCACAGGGTGCGGAACCTGGTGCTGGTC
AGCCGGCGCGGCTCCGACGCGCCGGGCGCCGCGGAGCTGACCGCCGAGCTGGCGGGACAA
GGGGCCCGGGTGACGTTCGCCGCCTGCGATCTGACCGACCGGCGGGCGCTGGCCGCGGTG
TTGGGCGCCGTCGGACCGGAGCATCCGCTGACCGCCGTCGTGCATACGGCGGGGATCCTG
GAGGACGGGGTCATCGGCTCGCAGTCGCAGGAGCAGCTCGATCGGGTACTGGCGCCGAAG
GTCGACGCGGTCTGGAACCTGCACGAGCTGACCCGCGAGTACGACCTGTCCCGGTTCGTG
GTGTTCTCGTCGCTGGCCGGACAGGTGGGGAACAGCGGGCAGGGCAACTACGCGGCGGGC
AATGTGTTCCTCGACAGCCTGATGGCGCGCCGCCGTGCCGAGGGGCTGCCCGGGCAGTCG
ATGGCCTGGGGCGCCTGGACGAACGACGTCGGCCTGGTCGGGACCCTGTCCGACACGGAT
CTGCGCCGCATCGCCCGGTCGGCGATGCCGCCGCTGGGTGTGGAACAGGGCATGAACCTG
TTCGATCGGGCGTGGGACTCGGGCGCCGCGGTGCTGGGGCTGGCCCGGCTCAACGTCCGG
GCGCTGCGCGCACAGCGGGATGTCGCACCGCTGTGGCGGTCGCTGACCGGCAACGCGGCG
CGGCGTTCCGCCGACAACACGCAGGGCGGCCGCGACGGCTTGGCGCGGCAGCTCACCGGG
ATGTCCACCGCGGACGGGCTGGCGATCCTCGTCGAGCTGGTGCGCGATGCCGCGGCAGCG
GTGCTCGGCCACGCGTCGAGCGCGCAGATCGACGCCGCGCAGCCGTTCGCCGAGCTGGGC
TTCGACTCGCTGACCGCGGTCGAGCTGCGCAACCTGCTGCAGGCCAGGACCGGAGCGATC
CTGCCCGCGAGCCTGGTGTTCGACTACCCGACCGTCACTCACGTCGCGAAGCATCTGGCG
GGCGCGTTCGACGACACCCGGCCGGCGGGCACGGCTCCGCTGCCGTCACCGGTCTCCGTC
ACCGACGACCCGATCGTCTTCGTCGGGATGGCGTGCCGCTTCCCCGGCGGCGTGGCGGAT
CCGGACGATCTCTGGCAGCTGGTCGCCGACGGAGCCGAGGGCATCACGCCGTTCCCCGCC
GACCGCGGCTGGGACCTCGACGCGGCGCTCGGCGCCTCGGCGACGGGCGAAGGCGGCTTC
CTGGCCGGCGTCGGCGAATTCGACGCGGCGTTCTTCCAGATCTCCCCGCGTGAGGCGCTG
GCCACCGACCCCCAGCAGCGGCTGTTGCTCGAGACCTCCTGGGAGGCGCTGGAACGTGCC
GGGATAGACCCGAACTCGCTGGCGGGCAGCCAGACCGGGGTGTTCACGGGCGCGTATCAC
ATGGGGTACAGCGAGCTGGTCGCCCGCGGCGGTGAACAGTTGCAGGGCCACCAGATCACC
GGCGCCGCGACCAGCGTCATCTCGGGCCGGGTGGCCTATACGCTCGGGCTCGAAGGCCCG
GCGATGAGTGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCGATGCACCTGGCGGCGCAG
GCGCTGCGGTCGGGCGAGTGCTCGCTCGCCCTCGCCGGCGGTGTGTCCGTGATGGCGTCG
GCTGACGCGTTCGCCTTGTTCACGATGCAGGGTGGTCTGGCTGCGGACGGCCGGTGCCGG
TCGTTCTCGGATGATGCCGATGGGACTGGGTGGTCCGAGGGTGTCGGTGTGGTGGTGATG
GAGCGGTTGTCGGATGCTCGTCGGCACGGTCATGAGGTGCTGGCGGTTTTCCGGTCGAGT
GCGGTGAATCAGGATGGTGCGTCGAACGGTTTGACGGCGCCGAACGGGCCGTCGCAGCAG
CGCGTGATCCGCCAGGCGTTGGCGGCGGCCGGTCTGTCCACTTCGGACGTCGATGTGGTC
GAGGCGCACGGCACCGGGACGAAGCTCGGTGATCCGATCGAGGCGCAGGCGGTACTGGCG
ACCTATGGTCAGGACCGGCCCGAGGGCCGGCCGTTGTGGCTGGGGTCGTTGAAGTCGAAC
ATCGGGCACGCCCAGGCGGCGGCCGGCGTGGCGAGCGTGATCAAGATGGTGATGGCGTTG
CGGCACGGCGTGCTGCCGAAGACGCTGCACGTGGCGGAGCCGACCACGCAGGTCGACTGG
TCCCGGGGCGAGGTGCGGCTGCTGACCGAGTCCGTCCCGTGGCCGGACACGGATCACCCG
CGCCGGGCCGGGGTGTCCGCGTTCGGTGTCAGCGGCACCAACGCGCACATCATCCTCGAA
GCGCCCGCCGACGCCGGGTCCGGACAGGGCGCCCCGCCCGCGGAGCCGTCCGGTGTCGGC
GACTTCGCCGTGGACGCTGTGGTGCCGTTGGTGCTCTCGGGCAAGTCGGGTGAGGCGGTG
CGGGCTCAGGCGGCTCGGTTGCTGGAGCACTGGGAGCGGTACCCGTCGGTGAGTGCGGTG
GATGTGGGTTGGTCGTTGGTGAGTTCGCGGGCGGTGTTCGGGCATCGGCTGGTGGTGGCG
GGAGGGGGTCGGGAGGAGTTGCTGGCCGGTCTGCGTGCGGTGGCTGCGGGTGAGGCGGCT
GCGGGTGTGGTGCGGGGTGTGGCGCGGGTGGGGAGCAAGGCGGTGTTCGTGTTCCCGGGT
CAGGGTGCGCAGTGGGTGGGGATGGGGCGGGAGTTGTTGGTTTCGTCGCCGGTGTTCGCG
CGGTCGATGCGTGATTGTGCGGTGGCGTTGGAGCCGTTTGTGGAGTGGTCGTTGGAGGAG
GTGCTGGGTGATGAGGTGGCGTTGGGGCGGGTGGATGTGGTGCAGCCGGTGTTGTGGGCG
GTGATGGTGTCGTTGGCTGCGGTGTGGCGGTCGTTCGGTGTGGAGCCGGCCGCGGTGGTG
GGGCATTCGCAGGGGGAGATCGCGGCGGCGTGTGTGGCTGGTGGTCTGTCGTTGGCGGAT
GGGGCGCGGGTGGTGGCGTTGCGCAGCCGGGCGATCGCGGACACTCTTGCCGGTGCTGGT
GGGATGGTGGCTTTGCCGCTGCCTGTCGGTCAGGTGCGTGATCTGCTTGCGGGGTACCCG
GATGTGTCGCTGGCGGCGGTCAATGGGCCGGTGTCGGTGGTGGTCGCGGGTGAGTCGGAC
GCGTTGGGTCGTTTGCTTGCCGAGTGTGAGGACCGGGGTGTCAGGGCGCGGCGGATCGCG
GTGGACTACGCGTCGCATTCGGGTCTGGTGGAGCGGGTCGAGGAGCGGTTGTTGACGGAT
TTGGCGTCGATCGTTCCGCGGTCGTCGGCTGTTCCGGTGTTCTCTTCGGTGACCGGTGGC
GTGATGGACACCGCGGAGTGGGATGCCGGGTACTGGTACCGGAACCTGCGGACGACGGTG
CGGTTCGAGGAGGCGCTCACGGCCGCGCTGGACGTCGGTGACCGCGTCGTGCTGGAGGTG
AGCCCGCATCCGGTCCTGGTGCCCGCGGTGCAGGACATCGTCGACGGCCGCGAGGACGCG
GTGACGGCGATGGGCACGCTGCGGCGCGGCGAAGGATCCCTGCACCGCATGGTCACCGCG
GTCGCCCAGGCCTCCACCTGCGGCCTGGTGGTGGACTGGACCAAGGTGTTCGCGGGCCGG
GACGCCGTGCGGGTGCCGCTGCCCACGTACGCGTTCCAGCACGAGCGCTACTGGCCCGAT
CCCGAACCGCTTGCCGTGCCGGTCGTGGTGGATCCGGCCGACGAGCGGTTCTGGGCCTCG
GTGGAACAGCAGGACGTGCGGTCGGTGGCCGAGACGCTCGGGCTGGACAGCGGCGTGGTC
GCGGCCATGGTGCCGGCGCTGGCGTCGTGGCGCGCCCGCCGCCGGGACGAGCACGCGGCC
GACAGCTGGCGTTACCGGGAGACGTGGAAACCACTCGGTGGCAGCCACTTCCAGGTGACC
TCCGGACGCCGGCTGGTCGTGGTCCCGGCCGGGAAGAGCGATGACGCCTGGGTGAGTGAC
GTGGTTGCCGTGCTCGGCGCGGACACTCTCGTGCTGGAGCACAGCGACGATGCGGCGTTG
AGCGGCAGGCTGCGGGCCGCGCTCGACGCCGATGTCCCGGTGACCGCCGTGCTGTCCCTC
ACCGCAGCGCTGGAACCGGACACGACCACCGCGCTCGCGAGCACCATCGCCCTCCTGCGG
GCACTGCGCGACACCGGTGCGCCGCCACTGTGGGTGGCGACTCGGGGCGCGGTGTCGGTC
GGCGGCCAGGATCCGGTGACGGCTCCGGGGCAGGGCGCCGCGTGGGGCCTGGGCCGCGTC
GCCGCGCTGGACCAGCCCGGCCTGTGGGGCGGTCTGATCGACCTGCCCGAGATCCTGGAC
ACGCGCAGCGCGCGCCTGGTCACCGCGGTGATGTCGGGCACCTCGGGTGAGGACCAGGTG
GCCGTGCGCGCGTCGGGGTTGTTCGGCCGGCGGCTGGTCCACGCGCCGGCACCCCGGTCC
CGCGCCGGGTCGTGGACGACCTCGGGGACGGCGCTGATCACCGGTGGCACCGGCGGGCTG
GGCGCGTACGTGGCCCGGTGGCTGGTGGAGCGGGGCAGTGACCACGTCGTGCTGGTGAGC
CGGCATGGCCCCGACGCCGAGGGCATGAAACAGCTGCGGCTGGAACTGGAGGTCGCCGGC
GCCGACGTGACGGTGGTGGCGTGCGACGTGGCCGACCGGGCGGCGCTGGCCGACGTGCTC
GCCGCCATTCCCGAAGACCGTCCACTGCGGACCGTCGTGCACGCCGCGGGTGTCGTGGGC
GAAACGGCACCACTGCCGTCGATGACCCGGGACCAGCTCGAATGGCCGGTGCGGGTCAAG
GTGGACGGCGCACGGCATCTGGACGAGCTGACCCGGGACCTGGACCTCGACGCGTTCGTG
CTGTTCTCCTCCGGCGCGGCGGCGTGGGGCAGCGGAGGGCAGGCGGGTTACGCCGCAGGC
AACGCCTTCCTCGACGCGCTGGCGCTGCACCGCCGTTCGCAGGGCCGGACCGCGACGTCG
GTCTCTTGGGGGGCATGGGACCAGGTCGGCATGTTGAGCGGTTCGGGTGTGGCACAACGG
GACCAGCTGGCCGCACTGGGCGTGGTGCCGATGCGGCCCGAGCTCGCGATCACCGAGTTG
GAGCACGCCGTGCGGGAGGGCGAGACCTCGCTCGTGGTCACGGACATGGACTGGGCGCGG
TTCGCGCCGGTGTTCACCGCGATGCGACCGAGTGCGCTCCTGTCGGACCTGTCGGAGGTC
CGGGCGGCGTTGAACGGTAGCGGGCAGGACGCCGAAGCACCCGGCGGCTGGCGAGGCCGG
CTGACCGGTCTGTCCGAGGCGGACCGTGAGCGGGCGGTGCTGGAGCTGGTTCGCGGTTCC
GCCGCGGTCGTGCTCGGACACGGCTCGGGCACGCAGGTTCCGCGGGAGAAACCCTTCAGC
GAGCTGGGTTTCGACTCGCTGACCGCGGTCGAGCTGCGGAACCTGCTGCAATCGGAATCG
GGTGCCGCGCTGCCCGCCAGTGTGGCCTTCGACTATCCGACGGCGGCCCGGCTGGCCCAT
TACCTCAGCGGCGTCCTGGAGCTGGGTGCGGCTGTGGAAGCCGAAGTCGTCGCGGAGCCG
CCGGTGCTGCCGGACGAAGACGAGACGGCCCTGCTCGCCGCGAACGCGGACGACCTCATC
GACCTCGCGCTGCGCGAAGACTGA
[0] AT104..421
[0] ACP470..540
[1] KS563..936
[1] AT1092..1413
[1] methoxymalonyl-ACP1285..1289
[1] dh1461..1626
[1] KR1912..2092
[1] ACP2188..2258
[2] KS2283..2657
[2] AT2816..3124
[2] malonyl-CoA3001..3005
[2] KR3425..3605
[2] ACP3709..3779
[3] KS3802..4174
[3] AT4329..4642
[3] methylmalonyl-CoA4516..4520
[3] dh4690..4856
[3] kr5145..5315
[3] ACP5396..5466
[4] KS5491..5867
[4] AT6025..6336
[4] malonyl-CoA6210..6214
[4] dh6383..6544
[4] KR6828..7006
[4] ACP7103..7177
[5] KS7199..7574
[5] AT7743..8059
[5] methylmalonyl-CoA7931..7935
[5] DH8106..8272
[5] ER8594..8900
[5] KR8910..9089
[5] ACP9190..9260
[6] KS9283..9651
[6] AT9815..10128
[6] methylmalonyl-CoA10003..10007
[6] KR10429..10609
[6] ACP10709..10783
[0] AT310..1263
[0] ACP1408..1620
[1] KS1687..2808
[1] AT3274..4239
[1] methoxymalonyl-ACP3853..3867
[1] dh4381..4878
[1] KR5734..6276
[1] ACP6562..6774
[2] KS6847..7971
[2] AT8446..9372
[2] malonyl-CoA9001..9015
[2] KR10273..10815
[2] ACP11125..11337
[3] KS11404..12522
[3] AT12985..13926
[3] methylmalonyl-CoA13546..13560
[3] dh14068..14568
[3] kr15433..15945
[3] ACP16186..16398
[4] KS16471..17601
[4] AT18073..19008
[4] malonyl-CoA18628..18642
[4] dh19147..19632
[4] KR20482..21018
[4] ACP21307..21531
[5] KS21595..22722
[5] AT23227..24177
[5] methylmalonyl-CoA23791..23805
[5] DH24316..24816
[5] ER25780..26700
[5] KR26728..27267
[5] ACP27568..27780
[6] KS27847..28953
[6] AT29443..30384
[6] methylmalonyl-CoA30007..30021
[6] KR31285..31827
[6] ACP32125..32349

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [100-223]  G3DSA:3.40.366.10 [291-408]  G3DSA:3.40.366.10 [1089-1215]  G3DSA:3.40.366.10 [1285-1402]  G3DSA:3.40.366.10 [2809-2936]  G3DSA:3.40.366.10 [3001-3115]  G3DSA:3.40.366.10 [4320-4449]  G3DSA:3.40.366.10 [4516-4625]  G3DSA:3.40.366.10 [6017-6145]  G3DSA:3.40.366.10 [6210-6325]  G3DSA:3.40.366.10 [7737-7863]  G3DSA:3.40.366.10 [7931-8046]  G3DSA:3.40.366.10 [9809-9935]  G3DSA:3.40.366.10 [10003-10120]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8910-9076]  1.99999999999999e-57 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [498-513]  PS00012 [2216-2231]  PS00012 [3737-3752]  PS00012 [5424-5439]  PS00012 [7135-7150]  PS00012 [9218-9233]  PS00012 [10741-10756]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [474-539]  1.8e-10 PF00550 [2192-2257]  6.00000000000001e-12 PF00550 [3715-3778]  2.6e-12 PF00550 [5399-5465]  1.3e-11 PF00550 [7110-7176]  2.7e-12 PF00550 [9193-9259]  1e-10 PF00550 [10717-10782]  7.59999999999999e-08 PF00550
PF00550   PP-binding
 [470-540]  PS50075 [2188-2258]  PS50075 [3709-3779]  PS50075 [5396-5466]  PS50075 [7103-7177]  PS50075 [9190-9260]  PS50075 [10709-10783]  PS50075
PS50075   ACP_DOMAIN
 [463-579]  2.90000354677981e-25 SSF47336 [2181-2299]  3.60000433965927e-25 SSF47336 [3702-3818]  3.80000697093586e-27 SSF47336 [5389-5507]  1.89999859865865e-26 SSF47336 [7100-7215]  2.10000267834031e-28 SSF47336 [9183-9299]  2.800005042611e-25 SSF47336 [10705-10800]  6.59999852526375e-18 SSF47336
SSF47336   ACP_like
 [470-543]  G3DSA:1.10.1200.10 [2188-2262]  G3DSA:1.10.1200.10 [3707-3783]  G3DSA:1.10.1200.10 [5396-5471]  G3DSA:1.10.1200.10 [7105-7180]  G3DSA:1.10.1200.10 [9190-9262]  G3DSA:1.10.1200.10 [10711-10784]  G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [8609-8742]  2.70000183580794e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [8735-8844]  2.5e-19 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [8614-8671]  2.3e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1912-2090]  3.99999999999998e-60 PF08659 [3425-3604]  3.5e-63 PF08659 [5145-5314]  3.99999999999998e-46 PF08659 [6828-7004]  1.9e-61 PF08659 [10429-10608]  1.09999999999999e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [563-812]  8.39999999999977e-91 PF00109 [2283-2531]  4.49999999999996e-88 PF00109 [3802-4048]  4.09999999999995e-88 PF00109 [5491-5741]  1.5e-88 PF00109 [7199-7449]  1.20000000000001e-87 PF00109 [9283-9526]  4.49999999999996e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [820-936]  1.80000000000002e-49 PF02801 [2539-2657]  4.70000000000003e-48 PF02801 [4056-4174]  1.5e-46 PF02801 [5749-5867]  1.2e-46 PF02801 [7457-7574]  2.59999999999998e-46 PF02801 [9534-9651]  3.89999999999997e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [104-421]  2.20000000000002e-97 PF00698 [1092-1413]  1.10000000000001e-96 PF00698 [2816-3124]  6.90000000000001e-61 PF00698 [4329-4642]  4.09999999999995e-94 PF00698 [6025-6336]  1.29999999999998e-64 PF00698 [7743-8059]  1.10000000000001e-97 PF00698 [9815-10128]  1.69999999999998e-96 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [101-391]  2.50000909916183e-62 SSF52151 [1090-1394]  5.59999989417026e-63 SSF52151 [2811-3117]  8.6000633021393e-73 SSF52151 [4327-4615]  3.89999861795218e-64 SSF52151 [6021-6309]  2.19999900980707e-69 SSF52151 [7741-8040]  6.20001486442668e-63 SSF52151 [9813-10112]  1.99999636034521e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [225-290]  1.29999924468179e-13 SSF55048 [1218-1284]  2.2999993566538e-13 SSF55048 [2938-3000]  3.49999466863949e-17 SSF55048 [4451-4515]  6.09999977126211e-16 SSF55048 [6147-6209]  3.59999643435987e-16 SSF55048 [7866-7930]  4.90001027782405e-17 SSF55048 [9938-10002]  4.90001027782405e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [565-824]  G3DSA:3.40.47.10 [825-987]  G3DSA:3.40.47.10 [2282-2541]  G3DSA:3.40.47.10 [2545-2707]  G3DSA:3.40.47.10 [3801-4058]  G3DSA:3.40.47.10 [4062-4226]  G3DSA:3.40.47.10 [5490-5751]  G3DSA:3.40.47.10 [5755-5917]  G3DSA:3.40.47.10 [7198-7459]  G3DSA:3.40.47.10 [7463-7625]  G3DSA:3.40.47.10 [9282-9536]  G3DSA:3.40.47.10 [9540-9702]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [555-988]  1.79999754022378e-106 SSF53901 [2275-2655]  2.99998750445706e-99 SSF53901 [3801-4226]  1.3000049540733e-98 SSF53901 [5483-5865]  2.89997807423187e-97 SSF53901 [7191-7627]  3.30001976117415e-99 SSF53901 [9282-9704]  3.10001307370203e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1913-2098]  G3DSA:3.40.50.720 [3425-3643]  G3DSA:3.40.50.720 [5145-5288]  G3DSA:3.40.50.720 [6829-7012]  G3DSA:3.40.50.720 [8732-8827]  6.79999999999998e-22 G3DSA:3.40.50.720 [8910-9095]  G3DSA:3.40.50.720 [10429-10634]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [725-741]  PS00606 [2444-2460]  PS00606 [3961-3977]  PS00606 [5654-5670]  PS00606 [7362-7378]  PS00606 [9439-9455]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [105-401]  1e-100 SM00827 [1094-1394]  8.70005082121738e-111 SM00827 [2816-3106]  5.20000089003336e-120 SM00827 [4331-4623]  1.09999184471405e-113 SM00827 [6025-6316]  5.60004908290974e-114 SM00827 [7745-8039]  5.10003242202156e-111 SM00827 [9817-10111]  5.20000089003336e-110 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [471-543]  2.39999798157265e-32 SM00823 [2189-2261]  1.79999754022375e-30 SM00823 [3710-3782]  8.5000302480906e-34 SM00823 [5397-5469]  1e-32 SM00823 [7108-7180]  6.90001478563507e-30 SM00823 [9191-9263]  1.70000295590054e-29 SM00823 [10714-10786]  9.59999914716171e-27 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1461-1626]  7.19996395544006e-74 SM00826 [4690-4856]  4.40002866058555e-78 SM00826 [6383-6544]  8.70005082121737e-74 SM00826 [8106-8272]  5.20000089003336e-74 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [565-988]  SM00825 [2285-2709]  SM00825 [3804-4226]  SM00825 [5493-5919]  SM00825 [7201-7627]  SM00825 [9285-9704]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1912-2092]  2.99998750445706e-60 SM00822 [3425-3605]  1.79999754022375e-60 SM00822 [5145-5315]  9.49996855930963e-40 SM00822 [6828-7006]  5.8999880940569e-61 SM00822 [8910-9089]  1.3000049540733e-56 SM00822 [10429-10609]  5.79999653854781e-54 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [8594-8900]  SM00829
SM00829   PKS_ER
SignalP
 [1-33]  0.114 Signal
Bacteria, Gram-negative   
TMHMM No significant hit