close all open/close all

CDS information : Tauto_00120


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction76,705 / 78,075 / + [in whole cluster]
76,705 / 78,075 / + [in contig]
Location76705..78075 [in whole cluster]
76705..78075 [in contig]
TypeCDS
Length1,371 bp (456 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative esterase
Product (GenBank)putative type B carboxylesterase
Gene
Gene (GenBank)ttmK
EC number3.1.1.-
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
Q9L378
PmId
[11178722] Cloning and characterization of a bacterial cell-bound type B carboxylesterase from Bacillus sp. BP-7. (Curr Microbiol. , 2001)

close this sectionSequence

selected fasta
>putative esterase [putative type B carboxylesterase]
MVETSSGSIRGFLDRGVPNWRGVPYGRVGHRFRPPEPVVPVERIDARHWGPVSWQLPIIL
GQTPSTVSPDATESENCLNLNIWSPDPNPDARRPVLMWLHFGSRAYGSGSTSTNDVWHFA
ARHDAVVVTANYRIGAWGWLYLGALDPDFKDSANLSMLDQIQALRWVKENVAAFGGDPDN
VTLFGLSSGSSDVAALLGAPAAKGLFHKAALYSGAQPPMAEERAARFAEDFLESAGPLAA
TPADLAQLPNVGLRTIHRRMLKQATSKSHGPAMIRYGPFVDGNVLPRSPLESLEMGLMAD
VPLLVSNVTEESGAWDAWNAIDTAYLRAFPEHDQSLPHKEKIDALSELIWVGPAKKLLAA
QHKGGAPVWYQQFDYAPSTNWRTVLAYPELANRPVHGADVACLFLDPEGTVGSDEDRAVG
AQDQAALLALARDGRVPWTPWTPESPAPHRIGVPAD
selected fasta
>putative esterase [putative type B carboxylesterase]
GTGGTGGAGACGTCGTCCGGCTCGATTCGGGGCTTCCTGGACCGGGGTGTCCCGAACTGG
CGCGGCGTGCCGTACGGTCGGGTCGGGCACCGGTTCCGGCCACCGGAACCGGTCGTCCCC
GTCGAGCGGATCGACGCACGCCACTGGGGCCCGGTCTCCTGGCAGCTGCCGATCATCCTC
GGCCAGACGCCCTCGACGGTGTCCCCCGACGCGACCGAGAGCGAAAACTGTCTCAACCTC
AACATCTGGTCGCCCGACCCGAACCCGGACGCGCGCCGGCCGGTGCTGATGTGGCTGCAC
TTCGGCAGCCGGGCCTACGGCAGCGGCAGCACGTCGACCAACGACGTCTGGCACTTCGCC
GCCCGGCACGACGCGGTAGTGGTCACCGCCAACTACCGGATCGGGGCCTGGGGCTGGCTC
TATCTGGGCGCGCTGGACCCGGACTTCAAGGACAGCGCCAACCTTTCCATGCTCGACCAG
ATCCAGGCGCTGCGCTGGGTCAAGGAGAACGTGGCCGCCTTCGGCGGCGACCCGGACAAC
GTCACGTTGTTCGGCCTGTCCTCCGGCTCGTCGGACGTGGCGGCTCTGCTGGGTGCTCCG
GCGGCCAAGGGGCTGTTCCACAAGGCGGCGCTCTACAGCGGCGCCCAGCCGCCGATGGCC
GAGGAGCGAGCCGCCCGGTTCGCCGAGGACTTCCTCGAGTCCGCCGGGCCGCTGGCGGCG
ACGCCGGCGGATCTCGCGCAGCTGCCCAACGTGGGGCTGCGCACCATCCATCGGCGGATG
CTGAAGCAGGCCACGTCCAAGTCCCACGGCCCGGCCATGATCCGGTACGGACCGTTCGTC
GACGGCAACGTCCTGCCCCGCAGCCCGCTCGAATCGCTGGAAATGGGGCTCATGGCCGAC
GTTCCGCTGCTCGTCTCGAACGTCACCGAGGAGAGCGGGGCGTGGGACGCCTGGAACGCC
ATCGACACGGCCTACCTGCGCGCGTTCCCCGAGCACGACCAGTCGCTGCCCCACAAGGAG
AAGATCGACGCCCTGTCCGAGCTGATCTGGGTGGGGCCGGCCAAAAAGCTGCTCGCCGCC
CAGCACAAGGGCGGCGCCCCGGTGTGGTACCAACAGTTCGACTACGCGCCCTCCACCAAC
TGGCGGACCGTGCTCGCCTATCCCGAGCTGGCGAACCGGCCGGTCCACGGCGCCGACGTG
GCCTGCCTGTTCCTCGACCCGGAAGGCACCGTCGGCTCCGACGAGGACCGTGCGGTCGGT
GCGCAGGACCAGGCGGCGCTGCTCGCCCTGGCCAGGGACGGGCGGGTGCCGTGGACGCCG
TGGACGCCGGAGTCACCGGCCCCGCACCGGATCGGCGTACCGGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002018 Carboxylesterase, type B (Domain)
 [2-317]  1.29999999999998e-67 PF00135
PF00135   COesterase
IPR019826 Carboxylesterase type B, active site (Active_site)
 [174-189]  PS00122
PS00122   CARBOXYLESTERASE_B_1
SignalP No significant hit
TMHMM No significant hit