close all open/close all

CDS information : Tauto_00130


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction78,664 / 78,092 / - [in whole cluster]
78,664 / 78,092 / - [in contig]
Locationcomplement(78092..78664) [in whole cluster]
complement(78092..78664) [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ttmL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [conserved hypothetical protein]
MALLGKLLKNRRAGETGLAWNAPNLTGPETVRVASPDFEHGATMPLAHAGKRSGGQNTSP
ALSWTGTPAGTAQLLLVVEDPDVPLPKPFVHGVFLLDAALTEVARGALDQNSATAGVRVL
RSGNGRGYLGADPIKGHGPHRYVFQLFALAKPITVVAGGADPESAKPRAVLDAADGVLAR
GRIDGCYENP
selected fasta
>hypothetical protein [conserved hypothetical protein]
ATGGCATTGCTCGGAAAGTTGCTGAAGAACCGGCGGGCGGGGGAGACGGGCCTGGCCTGG
AACGCGCCGAACCTGACGGGGCCCGAGACCGTGCGGGTGGCCAGTCCCGACTTCGAGCAC
GGGGCGACGATGCCGTTGGCGCACGCCGGGAAGCGGTCCGGCGGCCAGAACACCTCGCCG
GCACTGAGCTGGACCGGGACACCCGCCGGCACCGCGCAACTGCTCCTGGTCGTCGAGGAC
CCGGATGTGCCCCTCCCGAAGCCGTTCGTCCACGGAGTCTTCCTTCTCGACGCTGCGTTG
ACCGAAGTCGCGCGGGGTGCGCTCGACCAGAACAGTGCCACCGCGGGTGTGCGGGTGCTG
CGGTCCGGCAATGGACGCGGCTACCTGGGGGCGGACCCGATCAAGGGGCACGGCCCGCAC
CGGTACGTGTTCCAGCTCTTCGCGCTCGCGAAGCCGATCACCGTCGTGGCGGGCGGCGCG
GACCCCGAATCGGCCAAGCCGCGCGCCGTACTCGACGCTGCGGACGGGGTTCTCGCGCGT
GGCCGAATCGACGGCTGCTACGAGAACCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008914 Phosphatidylethanolamine-binding protein PEBP (Family)
 [30-189]  6.59999852526376e-28 SSF49777
SSF49777   PEBP
 [43-188]  4.29999999999999e-22 PF01161
PF01161   PBP
 [31-188]  1.3e-31 G3DSA:3.90.280.10
G3DSA:3.90.280.10   PEBP
SignalP No significant hit
TMHMM No significant hit