close all open/close all

CDS information : Tauto_00140


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction80,489 / 79,404 / - [in whole cluster]
80,489 / 79,404 / - [in contig]
Locationcomplement(79404..80489) [in whole cluster]
complement(79404..80489) [in contig]
TypeCDS
Length1,086 bp (361 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)phosphatase, methoxymalonyl-ACP biosynthesis protein
Gene
Gene (GenBank)ttmE
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[16707708] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus. (J Bacteriol. , 2006)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [phosphatase, methoxymalonyl-ACP biosynthesis protein]
MTATPMVKCLIWDLDDTLWRGTLLEDDGVRPFEWVREVITTLDGRGVLQSVASKNDHDHA
WSRLEEFGLAEYFVVPHIGWGPKSESVRAVAERLNFAHNTIAFIDDNPVERAEVAHHLAD
VRCYPAEEATGLVRRPEFSPAVVTVDSRRRRQMYRAGFERDAGRAEFTGPDEDFLRTLDL
EMTIGRATEQELSRVAELTLRTSQMNATGVHYDDATLRGLLADPGHEVLVVTLEDRFGPH
GAVGIVLLARHERAWHLKLLATSCRVVSLGVGSALLNWLSDQAARAGVHLVADLRRTDRN
RMMEIAYRFAGFTEHECACATGLPAPGVDGVERLHLVPARRPVPSTLSLTSPDLTSAALP
R
selected fasta
>putative glyceroyl-ACP biosynthesis protein [phosphatase, methoxymalonyl-ACP biosynthesis protein]
ATGACCGCGACGCCGATGGTGAAGTGCCTGATCTGGGACCTGGACGACACACTGTGGCGC
GGCACCCTGCTAGAGGATGACGGCGTGCGGCCGTTCGAGTGGGTGCGGGAGGTGATCACC
ACCCTCGACGGACGGGGTGTTCTGCAGTCCGTCGCCAGCAAGAACGACCACGACCACGCC
TGGTCGAGGCTGGAGGAGTTCGGGCTGGCCGAGTACTTCGTGGTGCCGCACATCGGCTGG
GGCCCGAAGTCGGAGTCGGTGCGCGCCGTCGCCGAGCGGCTGAACTTCGCGCACAACACG
ATCGCCTTCATCGACGACAACCCGGTCGAGCGTGCCGAGGTGGCACATCACCTGGCCGAC
GTGCGGTGTTACCCGGCCGAGGAGGCCACGGGGCTGGTCCGGCGGCCGGAGTTCAGTCCC
GCCGTCGTCACCGTCGACTCCCGCCGGCGGCGGCAGATGTACCGCGCCGGGTTCGAGCGC
GACGCCGGCCGGGCCGAGTTCACCGGCCCCGACGAGGACTTCCTGCGCACGCTCGACCTG
GAGATGACCATCGGGCGCGCCACCGAGCAGGAGCTGTCCCGCGTCGCGGAACTGACCCTG
CGCACCAGCCAGATGAACGCCACCGGCGTGCACTACGACGACGCGACGCTGCGCGGTCTG
CTCGCCGATCCCGGCCACGAGGTCCTGGTGGTGACGTTGGAGGACCGGTTCGGTCCGCAC
GGCGCCGTCGGCATCGTGCTGCTGGCCCGGCACGAGCGGGCCTGGCACCTCAAGCTGCTG
GCGACCTCGTGCCGGGTCGTGTCACTCGGCGTCGGCTCGGCCCTGCTGAACTGGCTGTCC
GACCAGGCCGCCCGCGCAGGTGTGCACCTCGTCGCCGACCTCCGCCGCACCGACCGCAAC
CGCATGATGGAGATCGCCTACCGGTTCGCGGGATTCACCGAGCACGAGTGTGCCTGCGCA
ACCGGCCTGCCGGCGCCGGGCGTCGACGGTGTCGAGCGCCTGCATCTCGTGCCGGCCCGC
CGTCCCGTGCCGAGCACACTGAGCCTGACCTCGCCCGACCTGACCAGCGCCGCGCTGCCC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [182-344]  PS51186
PS51186   GNAT
 [198-308]  2e-05 PF13673
PF13673   Acetyltransf_10
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [8-117]  2.1e-18 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [5-314]  1.69999999999998e-110 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [182-315]  1.9e-09 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [182-339]  8.1000073432326e-11 SSF55729
SSF55729   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [6-108]  1.1e-10 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [1-108]  3.00000067992871e-18 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit