close all open/close all

CDS information : Tauto_00150


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction81,607 / 80,486 / - [in whole cluster]
81,607 / 80,486 / - [in contig]
Locationcomplement(80486..81607) [in whole cluster]
complement(80486..81607) [in contig]
TypeCDS
Length1,122 bp (373 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)ttmA
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • ADH; methoxymalonyl-ACP biosynthesis protein
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[16707708] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus. (J Bacteriol. , 2006)
Related Reference
ACC
Q9KIE5
NITE
Asco_00090
PmId
[14623185] Crystal structure of an Acyl-ACP dehydrogenase from the FK520 polyketide biosynthetic pathway: insights into extender unit biosynthesis. (J Mol Biol. , 2003)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
ACC
Q8KUG3
NITE
Ansam_00170
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative oxidoreductase [acyl-CoA dehydrogenase]
MSDDLAGLVADRVGDRAAGWDIAGELPRDLLAELGGLGVLCAQVGVEHGGAGLDSRANGE
LTAAVGELCGSLRSVMTSQGMAAWAVRRLGTAEQREHFLRRLTSGELAAVGFSEPGAGSD
LAAMTTTITDGGSGELVVSGRKVWVTAAHYADLLVVFGGYRGGTTAVVVPADTPGVRVER
VPHPSGCRAAGHAGLVLDHVRVPADHMLGGVGLSFPLVVTAALTYGRMSVAWGCVGILRA
CLAAAVEHTGRREQFGTPLAGHQLVGRLLAELYVGEQIATRACEHASASWDEGAPEVAID
AVQAKYVASREAAAGASRAVQLLASAAASDGHVVARAYRDAKLMEIIEGTTEICQLLLAE
HVRGRAGTVRGRQ
selected fasta
>putative oxidoreductase [acyl-CoA dehydrogenase]
GTGAGCGACGACCTGGCCGGGCTCGTCGCCGACCGGGTGGGCGACCGCGCGGCGGGCTGG
GACATCGCCGGCGAGCTGCCCCGCGACCTGCTGGCCGAGCTGGGCGGGCTGGGCGTGCTG
TGTGCCCAGGTCGGCGTCGAGCACGGCGGCGCGGGACTGGACAGCCGGGCCAACGGCGAG
CTGACCGCCGCGGTCGGCGAGCTGTGTGGTTCGCTGCGCAGCGTCATGACCTCGCAGGGC
ATGGCCGCGTGGGCGGTCCGCCGGCTGGGCACCGCCGAGCAGCGCGAGCACTTCCTGCGC
CGGCTGACCTCGGGGGAGCTGGCCGCCGTCGGGTTCAGCGAACCGGGCGCGGGCAGCGAC
CTCGCCGCGATGACCACCACGATCACCGACGGCGGGTCCGGCGAACTCGTGGTCTCCGGC
CGCAAGGTGTGGGTCACCGCTGCCCACTACGCCGATCTGCTCGTCGTGTTCGGCGGCTAC
CGGGGCGGCACCACCGCCGTGGTGGTGCCCGCGGACACGCCGGGCGTGCGGGTCGAGCGG
GTGCCGCACCCCAGCGGGTGCCGTGCGGCCGGGCACGCCGGCCTGGTCCTCGACCACGTC
CGCGTGCCGGCCGACCACATGCTGGGCGGGGTCGGGCTGTCGTTCCCGCTGGTCGTCACG
GCGGCGCTGACCTACGGCCGGATGTCCGTCGCCTGGGGCTGTGTCGGCATCCTGCGCGCG
TGCCTGGCGGCGGCCGTCGAGCACACCGGCCGCCGCGAGCAGTTCGGAACTCCGCTCGCT
GGGCATCAGCTCGTCGGCCGGCTGCTCGCCGAACTGTATGTCGGCGAGCAGATCGCGACC
CGCGCCTGTGAGCACGCCAGCGCGTCGTGGGACGAGGGCGCGCCCGAGGTCGCCATCGAC
GCGGTGCAGGCCAAGTACGTCGCCTCCCGCGAGGCCGCCGCCGGGGCCTCCCGCGCGGTC
CAGCTCCTCGCGTCCGCCGCCGCGTCCGACGGCCACGTGGTGGCCCGCGCGTACCGGGAC
GCGAAGCTGATGGAGATCATCGAAGGCACCACCGAGATCTGCCAGCTCCTGCTCGCCGAA
CACGTGCGGGGCCGGGCGGGCACAGTGAGGGGACGGCAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [218-362]  1.1e-29 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [109-202]  6.50000000000001e-27 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [109-157]  4.00000000000001e-14 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [6-106]  2.5e-14 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [203-365]  4.39999999999997e-38 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [214-366]  2.70000183580794e-31 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-212]  1.10000150671643e-53 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [6-106]  1e-25 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-32]  0.07 Signal
Eukaryota   
TMHMM No significant hit