close all open/close all

CDS information : Tauto_00160


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction81,858 / 81,604 / - [in whole cluster]
81,858 / 81,604 / - [in contig]
Locationcomplement(81604..81858) [in whole cluster]
complement(81604..81858) [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)acyl-carrier protein
Gene
Gene (GenBank)ttmD
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • ACP; methoxymalonyl-ACP biosynthesis protein
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[16707708] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus. (J Bacteriol. , 2006)
Related Reference
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [acyl-carrier protein]
MKTSSEPVAEHVQAFLAERTRQTWARDTDLFATGGLSSMFAMELVVHLESTFDIVIAGPD
LALDNFRTVDAMTALVLRLREAER
selected fasta
>putative acyl carrier protein [acyl-carrier protein]
GTGAAGACATCCTCCGAGCCGGTGGCCGAGCACGTGCAGGCGTTCCTCGCCGAGCGCACC
AGGCAGACCTGGGCGCGGGACACGGACCTGTTCGCCACCGGCGGCCTGTCGTCCATGTTC
GCCATGGAGCTCGTGGTGCACCTGGAGTCCACTTTCGACATCGTGATCGCCGGTCCGGAT
CTCGCACTGGACAACTTCCGCACCGTCGACGCCATGACCGCGCTGGTGCTGCGGCTGCGG
GAAGCCGAGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [8-78]  7e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [4-80]  1.69999922284049e-11 SSF47336
SSF47336   ACP_like
 [22-76]  8.40000000000001e-06 PF00550
PF00550   PP-binding
SignalP
 [1-37]  0.056 Signal
Eukaryota   
 [1-41]  0.056 Signal
Bacteria, Gram-negative   
TMHMM No significant hit