close all open/close all

CDS information : Tauto_00170


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction82,724 / 81,855 / - [in whole cluster]
82,724 / 81,855 / - [in contig]
Locationcomplement(81855..82724) [in whole cluster]
complement(81855..82724) [in contig]
TypeCDS
Length870 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)3-hydroxyacyl-CoA dehydrogenase
Gene
Gene (GenBank)ttmB
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • BADH; methoxymalonyl-ACP biosynthesis protein
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[16707708] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus. (J Bacteriol. , 2006)
Related Reference
ACC
Q8KUG1
NITE
Ansam_00150
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q7BQ74
PmId
[16983083] Hydroxymalonyl-acyl carrier protein (ACP) and aminomalonyl-ACP are two additional type I polyketide synthase extender units. (Proc Natl Acad Sci U S A. , 2006)
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)
ACC
Q9ADL9
NITE
Soraph_00040
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [3-hydroxyacyl-CoA dehydrogenase]
MLREEVEDFSLAVLGAGTMGLGISALAVGHGVPVTLVETDAARARQAPAAVTVQLRMAQL
MNALPADRERGELTVTGSLAGTAGATVVIEAITEDLTLKTKVLAEAAALTGAEVPLVSNT
SSIPIDELAGHLPDAARLIGTHFMNPPYLISTVEVVRGASTGEATLSAVTRLLGALARKP
VVVGDGPGFVTSRILHPMINDAARVVQEGTATAEAVDTLMRECLGHRTGPLSTADLIGLD
NLVDSLRVLAERTGDQRAAPCELLLDKVRDGHLGRKTGRGFYDYGKAQP
selected fasta
>putative oxidoreductase [3-hydroxyacyl-CoA dehydrogenase]
ATGTTGCGCGAAGAGGTCGAAGACTTCTCGCTCGCCGTTCTCGGCGCGGGCACGATGGGT
CTGGGGATCAGCGCGCTCGCCGTGGGGCACGGCGTACCGGTCACACTCGTGGAGACCGAC
GCGGCGAGAGCCCGGCAGGCGCCGGCCGCGGTCACCGTGCAGCTGCGCATGGCCCAGCTG
ATGAACGCGCTGCCGGCGGACCGCGAGCGCGGCGAACTGACCGTCACCGGGTCGCTCGCC
GGCACGGCCGGTGCCACGGTGGTGATCGAAGCCATCACCGAGGATCTGACGCTCAAGACG
AAGGTGCTCGCGGAGGCCGCCGCACTGACCGGCGCCGAGGTACCGCTGGTCTCGAACACG
TCCTCGATCCCGATCGATGAGCTGGCCGGACACCTGCCGGACGCGGCGCGGTTGATCGGC
ACCCACTTCATGAACCCGCCGTACCTGATCTCGACGGTCGAGGTCGTCAGGGGCGCGAGC
ACCGGCGAGGCGACGCTTTCCGCAGTCACCCGGCTGCTCGGCGCCTTGGCGCGCAAACCG
GTCGTGGTCGGGGACGGGCCAGGGTTCGTGACCAGCCGCATCCTGCACCCGATGATCAAC
GACGCGGCCCGCGTCGTGCAGGAGGGCACCGCCACGGCCGAAGCCGTGGACACCCTGATG
CGCGAATGCCTCGGACACCGGACCGGTCCGCTGAGCACGGCGGACCTCATCGGCCTGGAC
AACCTGGTCGACTCGCTGCGGGTGCTGGCCGAGCGCACCGGCGATCAACGGGCGGCACCT
TGCGAGCTGCTGCTCGACAAGGTCCGCGACGGTCACCTCGGCCGTAAGACGGGCCGCGGC
TTCTACGACTACGGGAAGGCACAACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [188-284]  2.2e-30 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [11-185]  1.80000000000002e-45 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [188-285]  4.60000044330862e-30 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [190-284]  4.40000000000001e-30 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [10-189]  2.59999999999998e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [2-288]  1.60000240695997e-58 PIRSF000105
PIRSF000105   HCDH
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-27]  0.337 Signal
Bacteria, Gram-negative   
TMHMM No significant hit