close all open/close all

CDS information : Tauto_00180


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction83,548 / 82,892 / - [in whole cluster]
83,548 / 82,892 / - [in contig]
Locationcomplement(82892..83548) [in whole cluster]
complement(82892..83548) [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)O-methyl transferase
Gene
Gene (GenBank)ttmC
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • MT; methoxymalonyl-ACP biosynthesis protein
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[16707708] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus. (J Bacteriol. , 2006)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyl transferase]
MAQQITANQEILDYVRATSLRDDQVLAGLRAETATVPAAQALQVMPEEGQLLALLVGLTG
ARAVLEIGTFTGYSTLCMARALPTDGRLVTCDIAAKWPDMGRPFWEKAGVADLIEVRVGD
ARATLAALREEGAEFDFVFVDADKSGYLHYYEESLPLLRPGGLIVVDNTLFFGRVADPAV
TDIDTVSVRELNTRLHTDERVEICLLPMADGITLVRKK
selected fasta
>putative O-methyltransferase [O-methyl transferase]
ATGGCTCAGCAGATCACCGCGAACCAAGAAATACTCGACTACGTGCGGGCCACCTCCCTG
CGTGACGACCAGGTGCTCGCCGGGCTCCGGGCCGAGACGGCGACGGTGCCGGCGGCACAG
GCGTTGCAGGTGATGCCCGAGGAGGGACAGCTGCTCGCGCTGCTCGTCGGCCTCACCGGC
GCCCGCGCCGTGCTGGAGATCGGCACTTTCACCGGCTACAGCACGCTGTGCATGGCGCGC
GCCCTGCCGACCGACGGACGGCTGGTGACCTGCGACATCGCGGCGAAGTGGCCCGACATG
GGCAGGCCGTTCTGGGAGAAGGCGGGGGTGGCGGACCTGATCGAGGTGCGGGTCGGCGAC
GCCCGTGCCACGCTCGCGGCGCTGCGTGAGGAGGGCGCCGAGTTCGATTTCGTGTTCGTC
GACGCCGACAAGTCCGGATACCTCCACTATTACGAGGAATCGTTACCCCTGTTGCGCCCG
GGCGGACTGATTGTGGTGGACAACACGTTGTTCTTCGGCCGGGTCGCCGATCCGGCCGTG
ACGGACATCGACACCGTTTCGGTGCGCGAATTGAACACCCGGCTGCACACCGACGAGCGA
GTCGAAATCTGCTTGCTGCCGATGGCGGACGGAATCACGCTCGTCAGAAAAAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-218]  1.5e-80 PF01596
PF01596   Methyltransf_3
SignalP
 [1-41]  0.055 Signal
Eukaryota   
TMHMM No significant hit