close all open/close all

CDS information : Tauto_00190


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction84,723 / 83,662 / - [in whole cluster]
84,723 / 83,662 / - [in contig]
Locationcomplement(83662..84723) [in whole cluster]
complement(83662..84723) [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)predicted hydroxylase
Gene
Gene (GenBank)ttmM
EC number
Keyword
  • dialkylmaleic anhydride moiety
  • C-3'
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
[19281218] Functional characterization of ttmM unveils new tautomycin analogs and insight into tautomycin biosynthesis and activity. (Org Lett. , 2009)

close this sectionSequence

selected fasta
>hydroxylase [predicted hydroxylase]
MSILLNVEPGVSRAPDQEPWLHELTVPEAAEIDEAFATLLASGKSDFAAGEADFPLPRVG
PKLRCILRSLEDEPGFALVRGIPVAGKSEHEVRRLYWGLGMYLGVPLIQNNSDSHMVDIR
DEGRAGRLRVHSSNQHIGFHIDSTDIVGLLCRRAAAHGGTSLVVSAEAVRREISWVYPDL
LPALYEPLPFADVASPDEHHPDFFLCPVFGRHEGRTTTRFYLRRILRSQDNSAAPRLTDR
QRRAIEAVEEIAARPDLVTAMEFQPGDLQLINNHLVLHGRTTFDSEEADTGRHLLRMWWS
VPSSRPLPPEFEAAWGTREPGTLRGAARRWQLHGEFGEFQRRQADELGVVIPA
selected fasta
>hydroxylase [predicted hydroxylase]
ATGTCGATTCTGCTGAACGTGGAACCCGGAGTGTCGCGCGCGCCGGACCAGGAGCCGTGG
CTGCACGAGCTGACCGTGCCGGAGGCGGCCGAGATCGACGAAGCGTTCGCCACGCTGCTC
GCGAGCGGCAAGTCCGACTTCGCCGCCGGCGAGGCCGATTTCCCGCTGCCGAGGGTGGGG
CCGAAGCTGCGGTGCATCCTGCGGTCGTTGGAGGACGAGCCGGGTTTCGCGCTGGTCCGC
GGCATCCCGGTCGCAGGGAAGAGCGAGCACGAGGTCCGCCGCCTCTACTGGGGGCTCGGC
ATGTACCTCGGGGTGCCGCTCATCCAGAACAACTCCGACTCCCACATGGTCGACATCCGC
GACGAGGGCCGCGCGGGCAGGCTGCGGGTCCACAGCTCGAACCAGCACATCGGGTTCCAC
ATCGACTCGACGGACATCGTCGGGTTGCTCTGCCGGCGAGCCGCCGCCCACGGCGGCACC
AGCCTCGTCGTGAGTGCCGAAGCGGTGCGGCGGGAGATCTCGTGGGTGTACCCCGACCTG
CTGCCCGCGCTGTACGAACCGCTTCCGTTCGCCGACGTCGCCTCGCCGGACGAGCACCAC
CCCGATTTCTTCCTGTGCCCGGTGTTCGGCCGCCACGAGGGGCGGACCACGACGCGGTTC
TACCTCCGCCGGATCCTGCGCAGCCAGGACAACTCCGCGGCGCCGCGGCTGACCGACCGC
CAGCGGCGCGCCATCGAGGCGGTCGAGGAGATCGCGGCCCGGCCGGACCTGGTCACCGCC
ATGGAGTTCCAGCCGGGTGATCTGCAGCTGATCAACAACCACCTGGTGCTGCACGGCCGG
ACGACGTTCGACAGCGAAGAGGCGGACACCGGACGGCACCTGCTGCGCATGTGGTGGTCG
GTGCCGTCGAGCAGGCCGCTGCCGCCGGAGTTCGAGGCCGCCTGGGGCACCAGGGAACCC
GGCACGCTGCGGGGCGCGGCCCGGCGCTGGCAGCTGCACGGGGAGTTCGGCGAGTTCCAG
CGGAGGCAGGCCGACGAACTCGGGGTCGTCATCCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003819 Taurine catabolism dioxygenase TauD/TfdA (Family)
 [53-298]  6.60000000000002e-28 PF02668
PF02668   TauD
SignalP
 [1-29]  0.03 Signal
Bacteria, Gram-negative   
TMHMM No significant hit