close all open/close all

CDS information : Tauto_00210


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction86,805 / 85,861 / - [in whole cluster]
86,805 / 85,861 / - [in contig]
Locationcomplement(85861..86805) [in whole cluster]
complement(85861..86805) [in contig]
TypeCDS
Length945 bp (314 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative lyase
Product (GenBank)probable citrate lyase beta subunit
Gene
Gene (GenBank)ttmO
EC number
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
P17725
PmId
[7830578] Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization, sequencing, and expression. (Mol Microbiol. , 1994)
Family/Domain
FD
IPR005000

close this sectionSequence

selected fasta
>putative lyase [probable citrate lyase beta subunit]
MTDDHGKHRVFRSCLYVPGHHPDRIVRAYDTEADAVILDLEDAVPAPRKPEAREIVAEAM
ATPAAKPTYVRVNPMSSGLCEDDIRAVAGPALAGVRVAKVDSPADVLRVAEVLRELGHPA
KIHVLIESAVALEHAFALATASPEVTMLGLGESDLRVDLSTTAEGPTMDTSRARVIVAAR
AAGLPNPCQSVYAEPRDLRGLLVTSKHGRRLGFLGRMAIHPAQIPVIHDVYTPTTNEIDD
ALEICAAVNLAALESRSITITSQGKMVGPPVLARAKQVLELATALNLITDAAWPVEQART
SESVGYIRNKGGSS
selected fasta
>putative lyase [probable citrate lyase beta subunit]
ATGACCGACGACCACGGAAAGCACCGGGTGTTCCGCAGCTGCCTGTACGTGCCGGGCCAC
CACCCGGACCGGATCGTGCGCGCCTACGACACGGAGGCCGACGCGGTGATACTCGACCTG
GAGGACGCCGTCCCGGCCCCGCGCAAGCCCGAGGCTCGTGAGATCGTCGCCGAGGCCATG
GCCACGCCGGCCGCGAAGCCCACCTACGTGCGGGTCAACCCCATGTCGTCGGGCCTGTGC
GAGGACGACATCCGCGCGGTCGCGGGTCCCGCGCTCGCCGGGGTGCGGGTGGCCAAAGTG
GACTCGCCCGCCGACGTCCTGCGCGTCGCCGAGGTGCTGCGGGAGCTGGGACACCCGGCG
AAGATCCATGTGCTCATCGAATCGGCCGTCGCGCTGGAACACGCGTTCGCCCTGGCCACC
GCGTCGCCCGAGGTGACGATGCTCGGCCTCGGCGAGTCCGATCTCCGGGTCGACCTCAGC
ACCACCGCCGAGGGGCCGACCATGGACACCAGCCGGGCCCGCGTGATCGTCGCCGCGCGT
GCGGCCGGCCTGCCCAATCCGTGCCAGAGCGTGTACGCCGAGCCCCGCGATCTGCGCGGG
CTGCTGGTCACCAGCAAGCACGGCCGCCGGCTCGGGTTCCTCGGTCGCATGGCGATCCAC
CCGGCGCAGATCCCCGTCATCCACGACGTCTACACCCCGACCACGAACGAGATCGACGAC
GCGCTGGAGATCTGCGCCGCAGTGAACCTCGCAGCGCTGGAGAGCAGGTCGATCACCATC
ACGTCGCAGGGGAAGATGGTCGGCCCGCCCGTGCTCGCCCGGGCGAAGCAGGTCCTTGAG
CTGGCCACCGCGCTCAACCTGATCACGGATGCCGCGTGGCCGGTGGAGCAGGCACGAACT
TCGGAATCGGTGGGTTACATCCGGAACAAAGGAGGTTCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005000 Aldehyde-lyase domain (Domain)
 [12-221]  4.80000000000001e-32 PF03328
PF03328   HpcH_HpaI
IPR011206 Citrate lyase, beta subunit (Family)
 [1-289]  5.50001754266469e-73 PIRSF015582
PIRSF015582   Cit_lyase_B
IPR015813 Pyruvate/Phosphoenolpyruvate kinase (Domain)
 [8-232]  1.99999999999999e-67 G3DSA:3.20.20.60
G3DSA:3.20.20.60   Pyrv/PenolPyrv_Kinase_cat
 [7-232]  3.49999466863949e-60 SSF51621
SSF51621   Pyrv/PenolPyrv_Kinase_cat
SignalP No significant hit
TMHMM No significant hit