close all open/close all

CDS information : Tauto_00220


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction88,025 / 86,802 / - [in whole cluster]
88,025 / 86,802 / - [in contig]
Locationcomplement(86802..88025) [in whole cluster]
complement(86802..88025) [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative CoA transferase
Product (GenBank)predicted acyl-CoA transferases/carnitine dehydratase
Gene
Gene (GenBank)ttmP
EC number
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
Q1KLK0
PmId
[16547052] Properties of succinyl-coenzyme A:L-malate coenzyme A transferase and its role in the autotrophic 3-hydroxypropionate cycle of Chloroflexus aurantiacus. (J Bacteriol. , 2006)
ACC
Q1KLK1
PmId
[16547052] Properties of succinyl-coenzyme A:L-malate coenzyme A transferase and its role in the autotrophic 3-hydroxypropionate cycle of Chloroflexus aurantiacus. (J Bacteriol. , 2006)

close this sectionSequence

selected fasta
>putative CoA transferase [predicted acyl-CoA transferases/carnitine dehydratase]
MAIPRGRTECGRPALPALAAPLAGLTVIDASTLFAGPFAARLLGDFGAEIIKVEQPSGDP
LRRFGHAHDDVPLLWKVLSRNKKSVVLDLHEPEDAQRFRQLAAGADALIENFRPGTLERW
GLGPEVLAEANPRLVLARVTAFGQDGPYARRPGFGTLAEAMSGLAAMSGEPDGPPALPAF
PLGDAIAGLHAALAVLIALRARDVIGTGQIADIAITETLIGSLGAQLTVYEHLGLKPERI
GNRSNNSAPRGVYRCADDRWVAVSAPARSVAERVVRLVGRPELGAEPWFATGVGRAEHRE
LIDDAIRPWIAARCRDEVVDAFEAAEAAVAPIYEVDDVLADPQFRARGLTVDVPDAELGS
VRMPGVPFRLSATPGRIDWAGPPIGAHTEDVCGSVAPARSTAGEAGA
selected fasta
>putative CoA transferase [predicted acyl-CoA transferases/carnitine dehydratase]
ATGGCGATTCCGCGCGGCAGAACCGAATGTGGCAGGCCGGCCCTGCCCGCTCTCGCGGCA
CCTTTGGCCGGGCTCACCGTGATCGACGCCTCCACGCTGTTCGCGGGACCGTTCGCGGCG
AGACTGCTCGGGGACTTCGGCGCCGAGATCATCAAGGTGGAACAGCCCTCGGGTGATCCG
CTGCGCCGCTTCGGCCATGCGCACGACGACGTCCCGCTGCTGTGGAAGGTGCTGAGCCGC
AACAAGAAGAGCGTTGTGCTGGATCTGCACGAGCCTGAGGACGCGCAGCGGTTCCGCCAG
CTCGCCGCCGGGGCCGACGCCCTCATCGAGAACTTCAGGCCGGGCACCCTGGAACGCTGG
GGCCTCGGACCGGAGGTGCTCGCAGAGGCCAACCCTCGGCTGGTGCTGGCCAGGGTCACC
GCCTTCGGACAGGACGGCCCGTACGCACGCCGCCCCGGCTTCGGCACGTTGGCGGAAGCC
ATGAGCGGGCTGGCGGCGATGTCGGGTGAACCCGACGGGCCGCCCGCGCTCCCGGCGTTC
CCGCTCGGCGACGCCATCGCCGGCCTGCACGCGGCTCTCGCGGTGCTGATCGCGCTGCGC
GCCCGCGACGTGATCGGCACCGGCCAGATCGCGGACATTGCCATCACCGAGACGCTCATC
GGCTCACTGGGAGCCCAGCTCACCGTGTACGAACACCTCGGCCTCAAGCCCGAACGGATC
GGCAACCGGTCCAACAACAGCGCGCCTCGGGGCGTCTACCGTTGCGCGGACGACCGCTGG
GTCGCCGTCTCCGCCCCGGCGCGCTCGGTCGCCGAACGCGTCGTCCGGCTGGTCGGCCGC
CCCGAGCTGGGCGCTGAGCCGTGGTTCGCCACCGGGGTCGGTCGGGCCGAGCACCGCGAG
CTGATCGACGACGCGATCCGGCCGTGGATCGCAGCCCGGTGCCGGGACGAGGTCGTGGAC
GCCTTCGAGGCGGCCGAAGCGGCCGTCGCCCCCATCTACGAGGTCGACGACGTGCTGGCC
GATCCGCAGTTCCGGGCGCGCGGTCTCACCGTGGACGTGCCCGACGCCGAGCTCGGCTCG
GTGCGCATGCCCGGGGTCCCGTTCCGGCTGTCGGCCACTCCGGGCCGGATCGACTGGGCC
GGTCCGCCGATCGGCGCCCACACCGAGGACGTGTGCGGCTCCGTCGCGCCCGCCCGCTCG
ACGGCCGGGGAGGCCGGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [85-267]  1.99999999999999e-60 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [20-331]  2.39999999999997e-99 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
 [18-395]  3.30001976117415e-120 SSF89796
SSF89796   CoA-Trfase_fam_III
SignalP
 [1-30]  0.938 Signal
Eukaryota   
 [1-35]  0.706 Signal
Bacteria, Gram-positive   
 [1-35]  0.332 Signal
Bacteria, Gram-negative   
TMHMM No significant hit