close all open/close all

CDS information : Tauto_00230


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction88,381 / 89,436 / + [in whole cluster]
88,381 / 89,436 / + [in contig]
Location88381..89436 [in whole cluster]
88381..89436 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)predicted transcriptional regulator protein
Gene
Gene (GenBank)ttmQ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
Q8GI86
PmId
[12617515] kasT gene of Streptomyces kasugaensis M338-M1 encodes a DNA-binding protein which binds to intergenic region of kasU-kasJ in the kasugamycin biosynthesis gene cluster. (J Antibiot (Tokyo). , 2002)
ACC
Q54267
PmId
[8628239] The str gene cluster for the biosynthesis of 5'-hydroxystreptomycin in Streptomyces glaucescens GLA.0 (ETH 22794): new operons and evidence for pathway-specific regulation by StrR. (Mol Gen Genet. , 1996)

close this sectionSequence

selected fasta
>putative transcriptional regulator [predicted transcriptional regulator protein]
MSEYETTCQPSDGSPAFTDSEPASWLSGQLAASTVRSILISSLNLDFTLRQARVNTEHVR
ILAGITEELPPIVVHEPSGRVLDGIHRVRAALAQERNRISAIVYNGSDEDAFAVAVRLNT
AHGLPLSRAERIAAAERILRTHPRWSNRMIAGVTGLAESTVRVRRRDLPGPRSCTRVGRD
GRVRPVNAADGRLRASRLLAERPTASAREIAREAGVSPNTVLDVRRRLAEGREPVQARGG
EAGAPATPCPAGPSDLEKITEAMLVDLMADPSIRLNNRGRFLIRWMRANRQALNTRSDVV
CAIPDHWSVPVARLARAYSLFWQDLARQLEHRSAEPPRESADPLLEQPGLP
selected fasta
>putative transcriptional regulator [predicted transcriptional regulator protein]
ATGTCCGAGTACGAGACGACCTGTCAACCGAGCGACGGTTCGCCGGCCTTCACGGACTCC
GAACCGGCTTCCTGGCTGTCGGGGCAGCTGGCCGCGAGCACCGTCCGCAGCATTCTCATC
AGCTCACTCAACCTCGATTTCACCTTACGGCAAGCCCGGGTGAACACCGAACACGTGCGG
ATTCTCGCCGGGATCACCGAAGAACTGCCACCGATCGTCGTTCACGAACCATCGGGCCGG
GTCCTCGACGGAATCCACCGCGTCCGCGCAGCCTTGGCGCAGGAGCGGAACCGCATTTCC
GCCATTGTGTACAACGGTTCGGACGAGGACGCTTTCGCCGTGGCCGTCCGGCTCAACACC
GCACACGGGCTGCCGCTCTCGCGCGCGGAGCGAATCGCCGCCGCGGAACGGATCCTGCGC
ACCCACCCACGGTGGTCGAACCGCATGATCGCCGGAGTCACCGGGCTGGCGGAGTCGACC
GTCCGGGTGCGACGCCGCGACCTTCCCGGGCCCCGCTCCTGCACCCGGGTCGGCCGCGAC
GGCCGCGTCCGACCGGTGAACGCCGCCGATGGGCGACTGCGGGCCAGCCGGCTGCTCGCC
GAGCGCCCGACCGCGTCGGCGCGGGAAATCGCGCGTGAGGCCGGAGTCTCGCCGAACACC
GTGCTCGACGTGCGGCGCCGGCTCGCCGAGGGCCGGGAACCGGTCCAGGCCCGAGGCGGC
GAGGCCGGTGCACCGGCGACCCCTTGCCCCGCCGGGCCCAGCGACCTCGAGAAGATCACC
GAGGCCATGCTGGTCGACCTGATGGCGGATCCCTCGATCCGGCTCAACAACCGCGGGCGG
TTCCTGATCCGCTGGATGCGGGCCAACCGGCAAGCGCTCAACACCCGGTCCGACGTCGTC
TGCGCGATCCCCGACCACTGGTCGGTCCCCGTGGCCAGGCTGGCCCGGGCGTATTCGCTG
TTCTGGCAGGATCTGGCCCGGCAACTGGAACACCGGTCGGCGGAACCGCCCCGAGAGAGC
GCGGACCCGCTCCTCGAACAACCCGGCCTGCCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [35-122]  3.7999986264479e-09 SSF110849
SSF110849   ParBc
 [66-119]  4.9e-07 PF02195
PF02195   ParBc
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [192-230]  4.80000000000001e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit