close all open/close all

CDS information : Tauto_00240


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction90,853 / 89,450 / - [in whole cluster]
90,853 / 89,450 / - [in contig]
Locationcomplement(89450..90853) [in whole cluster]
complement(89450..90853) [in contig]
TypeCDS
Length1,404 bp (467 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative dehydratase
Product (GenBank)putative MmgE/PrpD family protein
Gene
Gene (GenBank)ttmR
EC number
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR005656

close this sectionSequence

selected fasta
>putative dehydratase [putative MmgE/PrpD family protein]
MTPAERLGALAELVANDGLPASRRSDVAGRVLDLLGNCLAALSERPAEAVAATVEEWGGS
PQATAIGSATRLPAPSAALLNGVLAHSLDFDDTHLPSVLHPSAAVVPAALAVAEQTDASG
PAFSDAVAVGVEVTCRLGMAGYDEQNANSVFFDRGQHATAICGTVGAAVAAGMLRGLSAA
RLTSAIGIACSMGSGIIEANRTGGTVKRIHCGWAAHAGVVAAALAGNGITGPPTVLEGRF
GLLRAFCGDRFDLEAVTRDLGERWESDRIFVKPYPCNHFTHAGVEAALRIRRRDVDPAII
TELTLGVPEPVLRTIAEPIEDKRRPLSGYHGAFSGPYTVAAALLGGGGLGLSHADFTDTA
VADPARLALAARVTPVADPECTRIFPHQFPAVLTVRLADGTVLEERVRHNLGGPENPLSA
ADLTAKFRMNARRAVDDAVAAELAALVTGLASDTRPAAITCLLRSAT
selected fasta
>putative dehydratase [putative MmgE/PrpD family protein]
GTGACCCCGGCCGAACGGCTGGGCGCGCTGGCCGAACTCGTCGCGAACGACGGACTGCCG
GCCAGCCGGCGGAGCGACGTCGCCGGCCGGGTGCTGGACCTGCTCGGCAACTGCCTCGCC
GCGCTTTCGGAGCGGCCGGCCGAGGCCGTCGCGGCCACGGTGGAGGAGTGGGGCGGTTCG
CCGCAGGCCACGGCGATCGGCTCGGCCACCCGCCTGCCCGCGCCGTCGGCCGCGCTGCTC
AACGGCGTGCTTGCGCACTCACTGGACTTCGACGACACACACTTGCCTTCGGTGCTGCAC
CCGTCAGCCGCGGTCGTGCCGGCGGCACTCGCCGTCGCGGAACAGACCGACGCGTCCGGG
CCCGCTTTCTCCGATGCCGTGGCCGTCGGGGTCGAGGTGACCTGCCGGCTGGGCATGGCC
GGCTACGACGAACAGAACGCGAACTCGGTGTTCTTCGACCGCGGCCAGCACGCCACCGCG
ATCTGCGGCACGGTCGGCGCCGCCGTCGCGGCCGGGATGCTGCGCGGGCTGAGCGCCGCT
CGGCTGACCTCGGCCATCGGCATCGCGTGCAGCATGGGTTCCGGGATCATCGAGGCCAAC
CGGACGGGCGGCACGGTCAAACGGATTCACTGCGGCTGGGCGGCGCACGCCGGGGTGGTG
GCCGCAGCGCTCGCCGGGAACGGGATCACCGGGCCGCCGACCGTGCTGGAAGGCCGGTTC
GGCCTGCTGCGCGCGTTCTGCGGCGACCGGTTCGACCTCGAAGCCGTGACCCGGGACCTC
GGCGAGCGGTGGGAGAGCGACCGGATCTTCGTGAAACCCTATCCCTGCAACCACTTCACC
CACGCCGGGGTGGAGGCCGCGTTGCGGATCCGGCGGCGCGATGTCGATCCCGCCATCATC
ACCGAGCTCACCCTCGGCGTGCCCGAACCGGTGCTGCGCACCATCGCCGAGCCGATCGAG
GACAAACGCCGGCCGCTGTCCGGTTACCACGGCGCGTTCAGCGGGCCGTATACGGTGGCC
GCCGCGTTGCTCGGCGGAGGCGGCCTCGGCCTGTCCCACGCCGACTTCACCGACACCGCG
GTGGCCGATCCGGCCCGCCTCGCGCTGGCCGCGAGGGTGACCCCGGTGGCCGACCCGGAG
TGCACGCGGATTTTCCCGCACCAGTTCCCGGCCGTGCTCACCGTGCGGCTCGCCGACGGC
ACCGTGCTCGAGGAACGGGTCCGGCACAACCTGGGCGGCCCGGAAAATCCGTTGTCCGCC
GCGGACTTGACGGCCAAGTTCCGCATGAACGCGCGGCGCGCGGTGGACGACGCGGTGGCC
GCTGAACTCGCCGCCCTGGTGACCGGGCTGGCTTCGGACACCAGGCCGGCGGCGATCACC
TGCCTGCTGCGTTCGGCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005656 MmgE/PrpD (Family)
 [3-438]  1.29999999999998e-78 PF03972
PF03972   MmgE_PrpD
 [1-465]  2.50000909916183e-106 SSF103378
SSF103378   MmgE_PrpD
SignalP No significant hit
TMHMM No significant hit