close all open/close all

CDS information : Tauto_00250


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction91,674 / 90,850 / - [in whole cluster]
91,674 / 90,850 / - [in contig]
Locationcomplement(90850..91674) [in whole cluster]
complement(90850..91674) [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productcyclase family protein
Product (GenBank)putative cyclase
Gene
Gene (GenBank)ttmS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR007325

close this sectionSequence

selected fasta
>cyclase family protein [putative cyclase]
MTDARTGALLAVLAKGVRTIELGHPLFTGMPCSPNHPGFRMTLARRHGDLRRPDGGSASS
EVIVTGGHVGTHIDALSHVSHDGRLHGGVDAETAQRGGAFSELGAEQIPPLVARALLLDV
AAVLGVDVLEPGYGVTRKDLLEAAERAGALPGPGDVVLVRTGWAAHFASPETYLGHATGV
PGVAEDAAEWLAEQGVVATGADTTAYERIPPGEGHRTLPVHRLLLVEHGIYLMEHLNLEE
IAASGLTEFPIVVSPLRIVGGTGSPIRPIAVVGA
selected fasta
>cyclase family protein [putative cyclase]
ATGACGGACGCGCGAACCGGTGCGCTGCTGGCCGTGCTGGCCAAGGGCGTGCGCACGATC
GAGCTGGGACACCCGCTGTTCACCGGCATGCCCTGCTCCCCGAACCATCCGGGTTTCCGG
ATGACGCTGGCGCGCCGGCACGGCGACCTGCGCCGGCCGGACGGCGGCTCGGCCAGCAGC
GAGGTGATCGTCACCGGCGGGCACGTGGGCACGCACATCGACGCGCTGTCGCACGTCAGC
CACGACGGCAGGCTGCACGGTGGCGTGGACGCGGAGACGGCCCAGCGCGGCGGTGCGTTC
AGCGAACTCGGCGCCGAACAGATCCCGCCGCTCGTCGCGCGGGCGCTGCTGCTCGACGTT
GCCGCAGTGCTCGGGGTGGACGTGCTCGAGCCGGGCTACGGCGTCACGCGGAAGGACCTG
CTGGAGGCCGCCGAGCGCGCCGGTGCCCTGCCCGGCCCCGGCGACGTCGTGCTGGTGCGG
ACCGGATGGGCGGCCCACTTCGCGAGCCCGGAGACCTACCTGGGGCACGCGACCGGCGTA
CCCGGCGTGGCCGAGGACGCGGCCGAATGGCTGGCCGAGCAGGGCGTCGTGGCCACCGGC
GCCGACACGACGGCCTACGAGCGGATCCCGCCGGGCGAAGGCCACCGGACGCTGCCGGTG
CACCGCCTGCTGCTGGTCGAGCACGGCATCTACCTGATGGAACACCTCAACCTGGAAGAG
ATCGCCGCGTCGGGTCTCACGGAGTTTCCCATCGTGGTTTCGCCGTTGCGCATCGTCGGT
GGCACCGGTTCCCCGATCCGGCCGATCGCGGTGGTGGGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [20-209]  1.29999999999998e-40 PF04199
PF04199   Cyclase
SignalP
 [1-19]  0.955 Signal
Eukaryota   
TMHMM No significant hit