close all open/close all

CDS information : Tauto_00260


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction92,509 / 91,736 / - [in whole cluster]
92,509 / 91,736 / - [in contig]
Locationcomplement(91736..92509) [in whole cluster]
complement(91736..92509) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)probable thioesterase
Gene
Gene (GenBank)ttmT
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [probable thioesterase]
MTGSTEYFENWVSTFNPAPSAAVRLACLPHAGGSASFFFPLAKAFGPDVEVMAVQYPGRQ
ARRNEPGIDNVPEYADHIFAALRQLADRPLALFGHSMGAVLAYEVALRMREAGLPAPVRL
FASGRRAPSRYRDEQVHKGTDVQIVAELRGLGGPNQSMLTDPEVLALILPAVRGDYRAIE
RYRHDPDARLDCPVTVLVGDEDPRVTLDEARAWAEHTTGPTELEVFGGGHFYLVDHGKEV
IDLLARRLSTQGTEPIR
selected fasta
>putative type II thioesterase [probable thioesterase]
GTGACGGGTTCGACTGAGTATTTCGAGAATTGGGTGTCGACGTTCAACCCGGCCCCGAGC
GCGGCGGTGCGTCTGGCCTGCCTGCCGCATGCCGGTGGCTCGGCGAGCTTTTTCTTCCCG
CTGGCCAAGGCGTTCGGTCCCGACGTCGAGGTGATGGCGGTGCAGTATCCCGGCCGCCAA
GCCCGGCGGAACGAACCGGGCATCGACAACGTACCCGAGTACGCGGACCACATTTTCGCG
GCGCTGCGGCAGCTGGCCGACCGGCCGCTGGCGTTGTTCGGTCACAGCATGGGCGCGGTG
CTCGCCTACGAGGTGGCGCTGCGGATGCGGGAAGCGGGGCTGCCCGCGCCTGTGCGGCTG
TTCGCCTCGGGGCGGCGCGCGCCCTCCCGGTACCGCGACGAGCAGGTGCACAAGGGCACG
GACGTGCAGATCGTGGCGGAGCTGCGGGGCCTCGGCGGGCCCAACCAGTCCATGCTCACC
GATCCGGAAGTGCTCGCCCTGATCCTCCCGGCCGTGCGCGGCGACTATCGCGCCATCGAA
CGCTATCGGCACGATCCCGATGCGCGCCTCGACTGCCCGGTGACGGTGCTCGTCGGTGAC
GAGGACCCTCGCGTCACCCTCGACGAGGCGCGGGCCTGGGCGGAGCACACCACCGGTCCG
ACGGAGCTGGAGGTGTTCGGCGGCGGGCACTTCTACCTCGTCGACCACGGCAAAGAAGTG
ATCGACCTACTGGCGCGCCGACTGAGCACGCAGGGAACCGAGCCCATCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-246]  1e-54 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit