close all open/close all

CDS information : Tauto_00280


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction92,966 / 93,553 / + [in whole cluster]
92,966 / 93,553 / + [in contig]
Location92966..93553 [in whole cluster]
92966..93553 [in contig]
TypeCDS
Length588 bp (195 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative LuxR family transcriptional regulator(fragment)
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf2
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Related Reference
ACC
A4KCF0
NITE
Tatmc_00140
PmId
[18832298] Identification of TmcN as a pathway-specific positive regulator of tautomycetin biosynthesis in Streptomyces sp. CK4412. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator(fragment) [hypothetical protein]
MCNFRQPPRPRSPRPANGRGRSSRSPSRDRARGAGPSITPGYRSPTANTCAACARRAKRK
RRLSSMLTTFRDLGALPGASRAEVEMRAADDRSVVVGGPADATTLTPQELKIVRLAADGL
TNKQIGRRLYLSPRIIDNHLHHAFPELGITSHINLRDALNSPIASDTPHHTPGAVRQCLG
NPAPAEGGDAAGHRT
selected fasta
>putative LuxR family transcriptional regulator(fragment) [hypothetical protein]
ATGTGCAATTTTCGGCAGCCGCCGCGGCCGCGCTCGCCGCGCCCAGCGAACGGGCGAGGG
CGCTCTTCGAGGTCGCCCTCGCGTGACCGGGCACGGGGCGCTGGTCCTTCGATCACACCC
GGGTACAGGTCGCCTACGGCGAACACCTGCGCCGCCTGCGCGCGACGGGCGAAGCGCAAA
CGCCGGCTGAGCAGCATGCTCACGACGTTCCGGGATCTCGGCGCGCTGCCCGGGGCCTCC
CGCGCCGAGGTGGAGATGCGGGCCGCCGACGACCGCAGCGTCGTCGTCGGTGGGCCTGCC
GACGCGACCACGCTGACGCCACAGGAGCTCAAGATCGTCAGGCTCGCCGCCGACGGCCTG
ACGAACAAGCAGATCGGCCGGCGGCTGTACCTCTCACCGCGAATCATCGACAACCACCTG
CACCACGCCTTCCCCGAACTGGGCATCACGTCCCACATCAACCTCCGCGACGCCCTCAAC
TCTCCGATCGCATCCGACACTCCGCACCACACGCCGGGCGCTGTGCGCCAGTGCCTCGGC
AACCCCGCCCCCGCGGAAGGCGGCGACGCGGCCGGCCACCGCACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [105-119]  1e-06 PR00038 [119-135]  1e-06 PR00038 [135-147]  1e-06 PR00038
PR00038   HTHLUXR
 [98-166]  PS50043
PS50043   HTH_LUXR_2
 [102-159]  1.89999859865864e-13 SM00421
SM00421   HTH_LUXR
 [104-154]  8.40000000000001e-10 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [66-112]  0.00011 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [113-155]  1.1e-14 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [93-162]  4.70000326671386e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-18]  0.494 Signal
Bacteria, Gram-negative   
 [1-31]  0.586 Signal
Bacteria, Gram-positive   
TMHMM No significant hit