close all open/close all
Tauto_00280 Tauto_00280   last last

CDS information : Tauto_00290


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction93,572 / 93,961 / + [in whole cluster]
93,572 / 93,961 / + [in contig]
Location93572..93961 [in whole cluster]
93572..93961 [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf3
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSQQANEAMAERLIELYNTDVHAMIDQCYPDDLRIKVNGVLALTDRDKFHKVESEVLGIA
PDRQAAITRLLHTGDDTVTVEGTCTFTDTESGSTRRTYWCSIWTITDGLVTSDSTYLDAS
VWTGVGSGK
selected fasta
>hypothetical protein [hypothetical protein]
ATGTCCCAGCAGGCCAACGAAGCGATGGCCGAACGCCTCATCGAGCTCTACAACACCGAC
GTGCACGCCATGATCGACCAGTGCTACCCGGACGATCTCCGGATCAAGGTCAACGGCGTC
CTCGCCCTCACCGACCGCGACAAGTTCCACAAAGTCGAATCCGAGGTCCTCGGTATCGCG
CCCGACCGCCAGGCCGCGATCACCCGCCTCCTGCACACCGGCGACGACACCGTCACCGTC
GAAGGCACCTGCACCTTCACCGACACCGAGTCCGGATCGACCCGCCGCACCTACTGGTGC
TCGATCTGGACCATCACCGACGGCCTCGTCACCTCCGACAGCACCTACCTCGACGCCTCC
GTGTGGACCGGAGTCGGCTCCGGCAAATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [11-111]  7.7e-08 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit
Tauto_00280 Tauto_00280   last last