close all open/close all
first first   Teicp2_00020 Teicp2_00020

CDS information : Teicp2_00010


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction529 / 41 / - [in whole cluster]
529 / 41 / - [in contig]
Locationcomplement(41..529) [in whole cluster]
complement(41..529) [in contig]
TypeCDS
Length489 bp (162 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tei1
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • similar to S. coelicolor hypothetical protein CAB95799.1
Reference
ACC

close this sectionSequence

selected fasta
>[hypothetical protein]
MTDAVMEEIRRAQEMNLGGDRAGARATLERLWETADDALHRCTIAHYLADLQGSVEDELR
WDELALREFPGLTDERAREYDATWQARAFLPSLHLNLADVHRRAGNRGRARHHLTEAVAA
LDALPADDYGAMIRDALDEVREAIDTGSTAPLRPASQAQKKP
selected fasta
>[hypothetical protein]
GTGACCGACGCCGTGATGGAAGAGATCCGCAGGGCGCAGGAGATGAACCTGGGCGGTGAT
CGGGCTGGAGCCCGCGCGACGCTGGAGCGCCTGTGGGAGACCGCCGACGACGCCCTGCAC
CGGTGCACCATCGCGCACTATCTCGCTGACCTGCAGGGCTCGGTGGAGGACGAACTGCGG
TGGGACGAGCTGGCGCTGCGGGAATTTCCCGGCCTCACCGACGAGCGCGCCCGCGAATAC
GACGCCACGTGGCAGGCCAGGGCATTCCTGCCCTCGTTACACCTCAACCTGGCCGACGTC
CACCGGCGCGCCGGCAACCGCGGGCGGGCTCGCCACCACCTCACCGAGGCGGTCGCCGCG
CTCGACGCGCTTCCCGCCGACGACTACGGCGCCATGATCCGCGACGCCCTCGACGAAGTA
CGCGAGGCCATCGACACGGGCTCCACCGCACCGCTGAGGCCGGCGAGTCAGGCGCAGAAG
AAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Teicp2_00020 Teicp2_00020