close all open/close all

CDS information : Teicp2_00020


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction1,899 / 1,369 / - [in whole cluster]
1,899 / 1,369 / - [in contig]
Locationcomplement(1369..1899) [in whole cluster]
complement(1369..1899) [in contig]
TypeCDS
Length531 bp (176 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tei2
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • similar to X. campestris hypothetical protein AAM40941.1
Reference
ACC

close this sectionSequence

selected fasta
>[hypothetical protein]
MLELITVGHGTAGRDELAALFTGAGLDRVVDVRRYPGSRHHPHVGVEALSRWLPEAGIAY
RADQRLGGRRRLPPESPDIWWRVEAFRAYAAHMRTAEFHEAVDELLTDIRAGTTAVMCSE
TLWWRCHRRLIADFVSEIHGFPVRHLDHRGRLARHRVAAGARWRSPDELVYDAAPP
selected fasta
>[hypothetical protein]
ATGCTGGAGCTGATCACTGTGGGGCACGGCACCGCCGGCCGGGACGAGCTGGCGGCGCTG
TTCACCGGGGCCGGGCTGGACCGGGTGGTGGACGTGCGCCGCTACCCCGGCAGCCGCCAC
CATCCACATGTCGGTGTCGAGGCGTTGAGCCGCTGGCTGCCGGAAGCCGGCATCGCCTAC
CGCGCCGACCAGCGGTTGGGCGGGCGCCGCCGCCTGCCGCCGGAATCACCGGACATCTGG
TGGCGGGTCGAGGCGTTCCGCGCCTACGCCGCGCACATGCGCACGGCCGAGTTCCACGAG
GCCGTCGACGAGCTGCTCACCGACATCCGGGCGGGCACCACCGCGGTGATGTGCAGCGAG
ACCCTGTGGTGGCGCTGCCACCGGCGCCTGATCGCCGACTTCGTCAGCGAGATCCACGGG
TTCCCGGTCCGCCACCTGGACCACCGCGGTCGGCTCGCCCGCCACCGGGTGGCCGCCGGC
GCCCGGTGGCGCTCCCCCGACGAGCTCGTTTACGACGCGGCCCCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007438 Protein of unknown function DUF488 (Family)
 [21-134]  1.4e-26 PF04343
PF04343   DUF488
IPR014519 Uncharacterised conserved protein UCP024492 (Family)
 [1-171]  2.1000026783403e-44 PIRSF024492
PIRSF024492   UCP024492
SignalP No significant hit
TMHMM No significant hit