close all open/close all

CDS information : Teicp2_00030


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction2,346 / 3,476 / + [in whole cluster]
2,346 / 3,476 / + [in contig]
Location2346..3476 [in whole cluster]
2346..3476 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative RCC1 repeats protein
Gene
Gene (GenBank)tei3
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>[putative RCC1 repeats protein]
MSTGIAVAAVAATAGSASASPALAAAPPATVAAGYAHTCAIRTGGTLWCWGSNANGQLGD
GTKTSRTTAVRVGDATTWAGVDAGTSHNCAVRTDGTLWCWGSNSRGQLGDGSTTDRTAPV
RVGTATNWTTVSAGDRHTCAVRTDGTLWCWGFNRLGQLGDGAQVYVATTPLQVGTASTWA
SVTTGFAHTCGTRTDGTLWCWGDSSAGQLGLGILSYRTTPGQVGTATNWATVTAGYTFTC
ATRTDGTLWCFGENGYGQLGVTGTYQASPVQVGSVATWTGVAAGFDTACASRADGSLWCW
GNNAAGQIGDGTTTHRYAPTRVGTATTWTAALAAGYHNCGFRTDDSLWCWGSNANGELGD
GTTTARPAPQQVSLPA
selected fasta
>[putative RCC1 repeats protein]
ATGTCGACCGGAATCGCGGTGGCCGCCGTCGCCGCCACCGCCGGATCCGCCTCCGCGAGC
CCCGCTCTCGCCGCCGCGCCGCCCGCGACGGTGGCCGCCGGTTACGCGCACACCTGCGCG
ATCCGGACCGGCGGGACCCTGTGGTGCTGGGGCTCCAACGCCAACGGCCAGCTCGGCGAC
GGCACGAAGACCAGCCGCACCACCGCGGTACGGGTCGGCGACGCCACCACGTGGGCCGGC
GTCGACGCCGGCACCAGCCACAACTGCGCGGTCCGGACGGACGGCACGCTGTGGTGCTGG
GGCAGCAACAGCCGCGGCCAGCTCGGCGACGGCAGCACCACCGACCGCACCGCCCCGGTC
CGCGTCGGCACCGCGACGAACTGGACCACGGTCAGCGCCGGCGACCGGCACACCTGCGCG
GTGCGTACCGACGGGACCCTGTGGTGCTGGGGCTTCAACCGGCTGGGGCAGCTCGGCGAC
GGCGCGCAGGTCTACGTCGCCACCACCCCGCTGCAGGTCGGCACGGCGAGCACCTGGGCG
AGCGTCACCACCGGTTTCGCGCACACCTGCGGGACGCGCACCGACGGCACCCTGTGGTGC
TGGGGCGACAGCTCGGCCGGGCAGCTCGGCCTCGGCATCCTCAGCTACCGGACCACCCCG
GGGCAGGTCGGCACCGCGACGAACTGGGCCACCGTGACCGCCGGGTACACCTTCACCTGC
GCGACCCGCACCGACGGCACCCTGTGGTGCTTCGGCGAGAACGGGTACGGCCAGCTCGGC
GTCACCGGCACGTACCAGGCGTCGCCGGTGCAGGTCGGCAGCGTGGCGACGTGGACCGGC
GTCGCGGCCGGCTTCGACACGGCGTGCGCGTCCCGCGCCGACGGCAGCCTGTGGTGCTGG
GGCAACAACGCGGCCGGGCAGATCGGCGACGGCACCACGACGCACCGCTACGCCCCGACC
CGGGTCGGCACCGCGACCACCTGGACGGCCGCCCTCGCGGCCGGCTACCACAACTGCGGC
TTCCGGACCGACGACAGCCTGTGGTGCTGGGGCAGCAACGCCAACGGGGAGCTCGGCGAC
GGCACCACCACCGCGCGCCCGGCCCCGCAGCAGGTGAGCCTGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000408 Regulator of chromosome condensation, RCC1 (Repeat)
 [45-94]  PS50012 [95-144]  PS50012 [145-195]  PS50012 [196-245]  PS50012 [295-345]  PS50012
PS50012   RCC1_3
 [28-41]  7.40000780398343e-12 PR00633 [47-63]  7.40000780398343e-12 PR00633 [131-147]  7.40000780398343e-12 PR00633 [147-161]  7.40000780398343e-12 PR00633 [235-253]  7.40000780398343e-12 PR00633 [290-311]  7.40000780398343e-12 PR00633
PR00633   RCCNDNSATION
 [94-141]  1.7e-13 PF00415 [344-375]  5.2e-05 PF00415
PF00415   RCC1
IPR009091 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (Domain)
 [28-324]  6.60000000000002e-97 G3DSA:2.130.10.30
G3DSA:2.130.10.30   Reg_csome_cond/b-lactamase_inh
 [33-374]  2.2999842048857e-81 SSF50985
SSF50985   RCC1/BLIP-II
SignalP
 [1-24]  0.776 Signal
Bacteria, Gram-positive   
 [1-19]  0.46 Signal
Eukaryota   
 [1-24]  0.819 Signal
Bacteria, Gram-negative   
TMHMM No significant hit