close all open/close all

CDS information : Teicp2_00040


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction4,628 / 3,552 / - [in whole cluster]
4,628 / 3,552 / - [in contig]
Locationcomplement(3552..4628) [in whole cluster]
complement(3552..4628) [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative glucanase
Gene
Gene (GenBank)tei4
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>[putative glucanase]
MPHRPRRIVTALVLTAALAVAGAVTGPVAHAGDRPATSTPTPPNPSPFPPTAPAGLTAAA
VHATSVTLTWTASRPGCCVVDHYEVQYRLAFNDVVALVDAGNVTSTTITGLAPARQYSFQ
VTAVDGVNHRSAPSTVVTVVTPVSDTAPDTSPPSAPTGLAATEVTASRAVLTWAPSTDDV
GVTGYDVYRFDGWYTSTLLTTTTATTYAVPTGGGRNVYYVRARDAAGNVSIASDTVSTVI
TTPSPSTPPPPEPVCRVGYRATSTWAGGFVAEVTVTNIGTEPIDGWTLTFAYGGDQRVSA
SWNGDVTQSGADVTVTGAAWNRRLGAGASATVGVLGSWRTSDAPPAAYTLNGRSCVTA
selected fasta
>[putative glucanase]
ATGCCGCACCGCCCGCGCAGGATCGTCACCGCTCTCGTCCTCACCGCCGCGCTCGCCGTG
GCCGGAGCCGTCACCGGCCCGGTCGCGCACGCCGGCGACCGACCGGCCACCTCCACCCCG
ACACCACCGAACCCGTCGCCGTTCCCGCCGACCGCGCCGGCCGGCCTGACCGCCGCCGCG
GTGCACGCCACCTCGGTGACGCTGACCTGGACCGCGTCGCGGCCGGGCTGCTGCGTCGTG
GACCACTACGAGGTCCAGTACCGCCTGGCGTTCAACGACGTCGTCGCGCTGGTCGACGCC
GGCAACGTCACCTCCACCACGATCACCGGCCTGGCGCCCGCCCGGCAGTACTCGTTCCAG
GTCACCGCGGTCGACGGCGTCAACCACCGGTCGGCGCCGTCCACCGTGGTCACCGTGGTC
ACCCCGGTGTCCGACACCGCGCCGGACACCAGCCCGCCGAGCGCGCCCACCGGCCTGGCC
GCCACCGAGGTCACCGCGTCCCGCGCGGTACTGACCTGGGCGCCGTCCACCGACGACGTC
GGCGTCACCGGCTACGACGTCTACCGGTTCGACGGGTGGTACACCTCCACCCTGCTCACC
ACCACCACCGCCACGACGTACGCCGTGCCGACCGGCGGCGGCCGGAACGTGTACTACGTA
CGGGCCCGCGACGCGGCGGGCAACGTGTCGATCGCCTCGGACACGGTCAGCACGGTGATC
ACCACCCCGTCGCCGAGCACTCCCCCGCCGCCCGAGCCGGTCTGCCGGGTCGGCTACCGC
GCCACCTCGACGTGGGCCGGGGGCTTCGTGGCCGAGGTGACCGTCACCAACATCGGGACG
GAACCGATCGACGGCTGGACGCTCACCTTCGCCTACGGCGGCGATCAGCGGGTGAGCGCG
TCGTGGAACGGCGACGTCACCCAGTCCGGCGCGGACGTCACGGTGACCGGGGCGGCATGG
AACCGCCGGCTCGGCGCCGGAGCGAGCGCCACGGTCGGGGTGCTGGGCTCCTGGCGGACC
AGCGACGCGCCGCCGGCGGCGTACACGCTCAACGGCCGGTCCTGCGTGACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001919 Cellulose-binding domain, family II, bacterial-type (Domain)
 [248-358]  PS51173
PS51173   CBM2
 [255-355]  2.1000026783403e-42 SM00637
SM00637   CBD_II
 [255-355]  2.2e-28 PF00553
PF00553   CBM_2
IPR003961 Fibronectin, type III (Domain)
 [48-142]  1.50000306971104e-21 SSF49265 [150-241]  1.59999889349252e-09 SSF49265
SSF49265   FN_III-like
 [52-131]  9.40000000000003e-14 PF00041
PF00041   fn3
 [49-140]  PS50853 [152-238]  PS50853
PS50853   FN3
 [50-131]  1e-12 SM00060 [153-229]  0.00210000037262656 SM00060
SM00060   FN3
IPR008965 Carbohydrate-binding domain (Domain)
 [249-358]  1.39999892049878e-32 SSF49384
SSF49384   Cellul_bind
IPR012291 Cellulose-binding family II/chitobiase, carbohydrate-binding domain (Domain)
 [251-356]  9.40000000000003e-35 G3DSA:2.60.40.290
G3DSA:2.60.40.290   CBD_carb_bd
IPR013783 Immunoglobulin-like fold (Domain)
 [49-144]  4.40000000000001e-23 G3DSA:2.60.40.10 [151-235]  3.39999999999999e-26 G3DSA:2.60.40.10
G3DSA:2.60.40.10   Ig-like_fold
SignalP
 [1-31]  0.707 Signal
Bacteria, Gram-positive   
 [1-31]  0.785 Signal
Bacteria, Gram-negative   
 [1-23]  0.79 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1