close all open/close all

CDS information : Teicp2_00050


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction5,079 / 6,608 / + [in whole cluster]
5,079 / 6,608 / + [in contig]
Location5079..6608 [in whole cluster]
5079..6608 [in contig]
TypeCDS
Length1,530 bp (509 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative membrane zinc protease
Gene
Gene (GenBank)tei5
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>[putative membrane zinc protease]
MVRTPLAVALAAGTVAASALVAVSGPAAAQAPAPSVDAVAQADAVVAARPAVLQAGKHDD
FHRRQVYKSQGLTYASYDRTYKGFPVKGGDFVVVTDNAGQTRYTSVAQSSPIGELSTEPT
VSESAAIATAKKQLKSVTSVEATRLVVVAAEGRAAKLAYETTVNGTGAEGVSRLTVDVDA
TTGAVLATEEHVTEATGTGTGWIVGSVSLNTTQSGSTYSLKDPTVTNLSCQDASTRTTFS
GSDNVWGNGTGTSKETGCVDALYAAQKQTAMLSAWLGRNGQNGSGGAWPIRVGLNQQNAY
YDGTQIQIGKNTAGKWISSLDVVGHELGHGIDDKTPGGISKGGTQEFVADTIGAATEAYA
ANPNDPFDYQVGEEVNLVGSGPIRYMYNPSLAGDDNCYSSSTPTDEVHAAAGPGNHWFYL
LAQGSGGNGQPASSTCNGSTVTGVGIQTAIKIMYNAMLLKTSSSSYAKYRVWTLQAAKNL
YPGSCTQFNAVKAAWNAVSLPAQSGEPTC
selected fasta
>[putative membrane zinc protease]
ATGGTTCGAACCCCCCTGGCCGTCGCCCTGGCGGCCGGCACCGTGGCCGCCTCGGCCCTG
GTCGCGGTGTCCGGTCCGGCAGCCGCGCAGGCGCCCGCCCCGTCCGTCGACGCGGTCGCG
CAGGCCGACGCCGTGGTCGCCGCCCGCCCGGCCGTACTGCAGGCCGGCAAGCACGACGAC
TTCCACCGGCGGCAGGTCTACAAGTCGCAGGGCCTGACCTACGCGTCCTACGACCGTACC
TACAAGGGCTTCCCGGTCAAGGGCGGCGACTTCGTCGTGGTCACCGACAACGCCGGTCAG
ACCCGGTACACGTCGGTCGCGCAGAGCAGCCCGATCGGTGAGCTCTCGACCGAGCCGACG
GTCTCCGAGAGCGCGGCGATCGCCACCGCCAAGAAGCAGCTCAAGAGCGTCACCAGCGTC
GAGGCCACCCGGCTGGTGGTCGTCGCGGCCGAGGGCCGCGCGGCGAAGCTGGCGTACGAG
ACCACGGTCAACGGCACCGGCGCGGAGGGCGTCAGCCGCCTCACCGTCGACGTGGACGCG
ACCACCGGCGCGGTGCTGGCCACCGAGGAGCACGTCACCGAGGCCACCGGCACGGGCACC
GGCTGGATCGTCGGCTCGGTGTCGCTGAACACCACGCAGTCCGGCTCGACGTACTCCCTC
AAGGACCCGACGGTCACCAACCTGAGCTGCCAGGACGCCTCCACCCGGACCACGTTCAGC
GGCTCGGACAACGTGTGGGGCAACGGCACCGGCACCAGCAAGGAGACCGGCTGCGTCGAC
GCGCTGTACGCGGCGCAGAAGCAGACCGCGATGCTGTCGGCGTGGCTGGGCCGCAACGGG
CAGAACGGCTCCGGCGGCGCGTGGCCGATCCGGGTCGGGCTGAACCAGCAGAACGCGTAC
TACGACGGCACCCAGATCCAGATCGGCAAGAACACCGCCGGCAAGTGGATCTCGTCGCTC
GACGTGGTCGGCCACGAGCTGGGTCACGGCATCGACGACAAGACCCCGGGCGGCATCTCG
AAGGGCGGCACCCAGGAGTTCGTCGCCGACACCATCGGCGCGGCCACCGAGGCGTACGCC
GCGAACCCCAACGACCCGTTCGACTACCAGGTCGGCGAGGAGGTCAACCTGGTCGGCAGC
GGCCCGATCCGGTACATGTACAACCCGTCGCTGGCCGGTGACGACAACTGCTACTCCAGC
AGCACCCCGACCGACGAGGTGCACGCCGCCGCCGGCCCCGGCAACCACTGGTTCTACCTG
CTGGCCCAGGGCAGCGGCGGCAACGGCCAGCCGGCCAGCTCCACCTGCAACGGCTCCACG
GTGACCGGTGTCGGCATCCAGACCGCCATCAAGATCATGTACAACGCGATGCTGCTGAAG
ACCTCCAGCTCCTCCTACGCCAAGTACCGCGTGTGGACGCTGCAGGCCGCGAAGAACCTG
TACCCGGGCAGCTGCACCCAGTTCAACGCGGTCAAGGCCGCGTGGAACGCGGTCAGCCTG
CCGGCCCAGTCCGGCGAGCCCACCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001570 Peptidase M4, C-terminal (Domain)
 [341-499]  7.7e-31 PF02868
PF02868   Peptidase_M4_C
 [342-499]  3.39999999999999e-31 G3DSA:1.10.390.10
G3DSA:1.10.390.10   Peptidase_M4/M36
IPR011096 FTP domain (Domain)
 [69-104]  4.6e-07 PF07504
PF07504   FTP
IPR013856 Peptidase M4 domain (Domain)
 [196-335]  3.90000000000001e-23 G3DSA:3.10.170.10
G3DSA:3.10.170.10   Peptidase_M4
 [195-331]  9.8e-16 PF01447
PF01447   Peptidase_M4
IPR025711 PepSY domain (Domain)
 [121-188]  1.3e-06 PF03413
PF03413   PepSY
SignalP
 [1-29]  0.683 Signal
Bacteria, Gram-positive   
 [1-29]  0.731 Signal
Bacteria, Gram-negative   
 [1-29]  0.644 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1