close all open/close all

CDS information : Teicp2_00060


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction7,079 / 6,744 / - [in whole cluster]
7,079 / 6,744 / - [in contig]
Locationcomplement(6744..7079) [in whole cluster]
complement(6744..7079) [in contig]
TypeCDS
Length336 bp (111 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative mannose-6-phosphate isomerase
Gene
Gene (GenBank)tei6
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [putative mannose-6-phosphate isomerase]
MLTKITPAAEAASLDEYWSQRVLTAANGNLFKVAKGLGSTRWHAHDDQDETFLMLAGTLT
VHLRDGSVELTPGDLLVIPRGVEHRPEAAGEARFLLVGPEVTSTEAGGKPA
selected fasta
>hypothetical protein [putative mannose-6-phosphate isomerase]
ATGCTGACGAAGATCACCCCGGCGGCCGAAGCGGCGTCGCTCGACGAGTACTGGTCCCAG
CGGGTCCTGACGGCCGCGAACGGCAACCTGTTCAAGGTGGCCAAGGGCCTCGGTTCCACG
CGATGGCACGCGCATGACGATCAGGACGAGACGTTCCTGATGCTGGCCGGAACGCTGACC
GTGCACCTGCGGGACGGCTCGGTCGAGCTGACCCCGGGTGACCTGCTGGTCATCCCGCGC
GGGGTGGAGCACCGCCCGGAGGCGGCCGGCGAGGCCCGTTTCCTGCTCGTCGGACCGGAG
GTCACCTCGACCGAGGCGGGCGGGAAGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [15-100]  1.70000295590054e-18 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [30-97]  3.7e-15 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [2-100]  5.00000000000001e-30 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit