close all open/close all

CDS information : Teicp2_00070


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction8,123 / 7,158 / - [in whole cluster]
8,123 / 7,158 / - [in contig]
Locationcomplement(7158..8123) [in whole cluster]
complement(7158..8123) [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)putative AraC-family transcription regulator
Gene
Gene (GenBank)tei7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q6ZZK7
NITE
Teicp_00010
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q9S166
PmId
[10540289] The A-factor regulatory cascade leading to streptomycin biosynthesis in Streptomyces griseus : identification of a target gene of the A-factor receptor. (Mol Microbiol. , 1999)
ACC
B6V2A5
PmId
[24694298] Identified members of the Streptomyces lividans AdpA regulon involved in differentiation and secondary metabolism. (BMC Microbiol. , 2014)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [putative AraC-family transcription regulator]
MVPRRVALIVDEHSNPFEVGCACEIFGGRRRPQIGYELYELTVVSPTRSVPMRDRLFRVS
APGRLSDLDRADMIIVPNRPDVDVPSRGAVLAAIRRAHARGARLVGLCTGAFTLAEAGVL
DGRRAAVHWQLAPDFHRRFPAVRLEPDVLFVDDGDILTSAGSAAALDLGLHIVRRDHGTE
VANRVGRQLVFAAFRDGGQRQFVERPLPAPATSPLAPVLQWAQERLHLRLSVDDLARHGR
MSTATLHRRFRNEVGSTPLAWLTAQRVALACRLIEQGAAGVDAVARQSGLGTAANLRALL
RKHVGLSPSEYRRRFAADGAR
selected fasta
>putative AraC family transcriptional regulator [putative AraC-family transcription regulator]
ATGGTGCCGCGGCGGGTCGCGCTGATAGTCGACGAACATTCCAACCCGTTCGAGGTGGGC
TGTGCCTGCGAGATCTTCGGCGGCCGCCGGCGCCCACAGATCGGCTACGAGCTGTACGAA
CTCACCGTCGTCAGCCCGACCAGATCGGTACCGATGCGGGACCGGCTGTTCCGCGTCAGC
GCGCCCGGGCGGCTGAGCGACCTGGACCGGGCCGACATGATCATCGTGCCGAACCGGCCG
GATGTCGACGTCCCGTCCCGCGGCGCGGTCCTGGCGGCGATCCGGCGGGCCCACGCGCGG
GGCGCCCGCCTGGTCGGCCTCTGCACCGGCGCCTTCACGCTCGCCGAGGCGGGGGTGCTC
GACGGCCGCCGCGCGGCGGTGCACTGGCAGCTGGCTCCGGACTTCCACCGGCGCTTCCCG
GCCGTACGGCTGGAGCCGGACGTGCTGTTCGTCGATGACGGCGACATCCTGACCTCGGCG
GGCAGCGCGGCGGCGCTCGACCTCGGCCTGCACATCGTCCGCCGCGACCACGGCACCGAG
GTGGCCAACCGGGTCGGCCGGCAGCTGGTGTTCGCCGCGTTCCGCGACGGCGGCCAGCGG
CAGTTCGTCGAACGCCCGCTGCCGGCGCCGGCGACGAGCCCGCTCGCGCCGGTCCTGCAG
TGGGCGCAGGAGCGCCTGCACCTGCGGCTGTCGGTCGACGACCTGGCCCGGCACGGCCGG
ATGAGCACCGCCACGCTGCACCGGCGCTTCCGCAACGAGGTGGGCAGCACCCCGCTGGCG
TGGCTGACCGCGCAGCGCGTCGCGCTGGCGTGCCGCCTGATCGAGCAGGGCGCCGCGGGC
GTGGACGCCGTGGCCCGGCAGTCCGGTCTGGGCACCGCCGCCAACCTGCGCGCCCTGCTG
CGTAAGCACGTGGGCCTGAGCCCGTCGGAGTACCGCCGGCGCTTCGCCGCCGACGGCGCG
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [211-262]  4.99999811956429e-08 SSF46689 [265-315]  4.99999811956429e-08 SSF46689
SSF46689   Homeodomain_like
 [219-265]  2.7e-17 G3DSA:1.10.10.60 [266-315]  1.2e-09 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [216-314]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [229-312]  1.39999892049878e-22 SM00342
SM00342   HTH_ARAC
IPR025628 DJ-1 domain, InhA-type (Domain)
 [37-174]  2.3e-31 PF13278
PF13278   DUF4066
SignalP No significant hit
TMHMM No significant hit