close all open/close all

CDS information : Teicp2_00080


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction9,179 / 8,427 / - [in whole cluster]
9,179 / 8,427 / - [in contig]
Locationcomplement(8427..9179) [in whole cluster]
complement(8427..9179) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative TetR-family transcitpional regulator
Gene
Gene (GenBank)tei8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q6ZZK6
NITE
Teicp_00020
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcitpional regulator]
MSATQEPGTSSRRRGGAGPVDDATVRAALIQAAERQLTASPDGDIATRAVSEEAGVTQPV
LYRLFGDKRGLLDAVADAGFDRYARRKSELEVTDNPVGDLYAGWDDHMAFATENPALYQL
MFAPRPRSGATTYRRILTLLEATLLRCAAAGALTTTPRAAAQLILSANIGVALGRIAAPE
LFDDPALSHRARDAAFATVLTHPATPSGPDPLRDAARQLRSQLSLSGTDRLEPAETVLLD
RWLERIDQPE
selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcitpional regulator]
ATGAGTGCTACGCAGGAGCCCGGCACGTCCTCCCGGCGGCGTGGCGGTGCGGGGCCCGTC
GACGACGCCACCGTCCGCGCCGCCCTGATCCAGGCCGCCGAGCGGCAGCTGACCGCCTCC
CCGGACGGCGACATCGCCACCCGCGCCGTCAGCGAGGAGGCCGGCGTCACCCAGCCGGTG
CTGTACCGGCTGTTCGGTGACAAACGCGGCCTGCTGGACGCCGTCGCCGACGCCGGATTC
GACCGCTACGCCCGGCGCAAGAGCGAACTGGAGGTCACCGACAACCCGGTCGGCGACCTG
TACGCGGGATGGGACGACCACATGGCGTTCGCCACCGAGAACCCGGCCCTCTACCAGCTG
ATGTTCGCGCCCCGGCCGCGTTCGGGCGCGACCACCTACCGCCGCATCCTGACACTGCTC
GAGGCCACCCTCCTGCGCTGCGCCGCCGCCGGCGCGCTCACCACGACGCCCCGGGCAGCC
GCCCAGCTGATCCTGAGCGCCAACATCGGCGTCGCTCTCGGCCGCATCGCCGCGCCGGAG
CTCTTCGACGACCCGGCGCTGTCGCACCGCGCCCGCGACGCCGCCTTCGCCACCGTGCTC
ACCCACCCCGCCACGCCGAGCGGGCCGGACCCGCTCCGCGACGCCGCCCGCCAGCTGCGC
TCGCAGCTCTCGCTCAGCGGCACCGACCGGCTGGAACCGGCCGAGACCGTGCTGCTCGAC
CGGTGGCTGGAGCGCATCGACCAGCCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [23-83]  PS50977
PS50977   HTH_TETR_2
 [29-75]  1.6e-07 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [21-99]  3.00000067992871e-11 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [95-202]  3.69999844802221e-06 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [23-214]  3.60000000000001e-25 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [107-172]  5.3e-07 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit