close all open/close all

CDS information : Teicp2_00100


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction10,677 / 12,020 / + [in whole cluster]
10,677 / 12,020 / + [in contig]
Location10677..12020 [in whole cluster]
10677..12020 [in contig]
TypeCDS
Length1,344 bp (447 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductUDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase
Product (GenBank)murF-like protein
Genetcp1
murF2
Gene (GenBank)tcp1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)
Related Reference
ACC
Q6ZZK4
NITE
Teicp_00040
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase [murF-like protein]
MIPLSLEAIAAVVGGTVEGDHTVTVTAPAVLDGRQAEPGGLFVAFAGEHVDGHDYAGQAG
QAGAVAVLGSRPTALPTVVVEDARTALQALAADVVARLRERLTLVGVTGSQGKTSTKDLL
AAVLSSAAPTIATKGNLNNELGVPLTMLRAGAATRFLVVEMGARRIGDLAKLTDLVPLDV
AVVLNVGEAHLGVFGSRAAIAEGKGELVRGLVPGGTAILNADDPRVVAMRSLTDGPVLTF
GHAEDADVRVRDLTLDRLGRPSFTLRTADATARVKLPIVGAHQALNAAAAVAAALSAGLT
LDAAAAPLATASLTRWRLELRDIAGGVTLLNDSYNASPGSTRAALDALAAIEGGRRVAVL
GQMLELGDESEAEHRAVGEYAAARADVVVTVGEAVRPLAVGAGERAVAVADNGAAVDWLR
GHLAPGDVVLVKASRGARLDEVAAALS
selected fasta
>UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase [murF-like protein]
ATGATCCCGCTCAGCCTCGAGGCGATCGCCGCTGTTGTCGGGGGGACGGTCGAGGGAGAC
CACACGGTGACGGTCACCGCGCCGGCCGTGCTCGACGGTCGGCAGGCCGAGCCGGGCGGC
CTCTTCGTCGCCTTCGCCGGCGAGCACGTCGACGGCCACGACTACGCCGGCCAGGCCGGC
CAGGCGGGCGCGGTCGCCGTGCTCGGCTCGCGGCCCACGGCGCTTCCCACCGTCGTCGTC
GAAGACGCCCGGACCGCGCTGCAGGCCCTCGCCGCCGACGTCGTGGCGCGGCTGCGTGAA
CGGTTGACGCTCGTCGGGGTGACCGGCTCCCAGGGCAAGACGAGCACCAAGGACCTGCTG
GCCGCCGTGCTGTCGAGCGCCGCGCCGACGATCGCCACCAAGGGCAACCTCAACAACGAG
CTCGGCGTGCCCCTCACCATGCTGCGCGCCGGTGCGGCCACCCGGTTCCTCGTCGTCGAG
ATGGGCGCCCGCCGCATCGGTGACCTCGCCAAGCTCACCGACCTGGTTCCGCTCGACGTC
GCCGTCGTCCTCAACGTCGGCGAGGCCCACCTCGGCGTGTTCGGATCGCGTGCGGCCATC
GCCGAGGGCAAGGGGGAGCTGGTACGAGGGCTGGTGCCCGGGGGTACCGCGATCCTCAAC
GCGGACGACCCCAGGGTGGTCGCGATGCGCTCGCTCACCGATGGCCCGGTGTTGACGTTC
GGGCACGCGGAAGACGCGGATGTGCGGGTGCGCGACCTGACCCTGGACCGGCTCGGCCGA
CCGTCCTTCACGCTGCGCACCGCGGACGCCACGGCCCGGGTCAAGTTGCCGATCGTGGGC
GCCCACCAGGCACTCAACGCCGCAGCCGCGGTGGCGGCGGCGCTTTCCGCCGGCCTGACG
CTCGACGCGGCCGCGGCGCCACTGGCCACCGCCTCACTGACGAGGTGGCGCTTGGAGCTA
CGTGACATCGCCGGCGGCGTGACACTGCTCAACGACTCCTACAACGCCAGCCCCGGGTCG
ACGCGAGCCGCGCTGGACGCCCTGGCCGCGATCGAGGGTGGCCGCCGCGTCGCCGTCCTC
GGCCAGATGCTGGAGCTGGGGGACGAGAGCGAGGCCGAGCACCGCGCCGTCGGGGAGTAC
GCCGCCGCCCGGGCCGACGTGGTGGTCACCGTCGGCGAGGCGGTTCGTCCGCTTGCCGTC
GGCGCGGGGGAGCGGGCGGTGGCAGTGGCGGACAACGGCGCGGCCGTCGATTGGCTTCGT
GGCCACCTCGCCCCCGGCGATGTGGTGCTCGTCAAGGCATCCCGTGGGGCGCGCCTCGAT
GAAGTCGCCGCCGCGCTGTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000713 Mur ligase, N-terminal (Domain)
 [31-93]  2.6e-13 PF01225
PF01225   Mur_ligase
IPR004101 Mur ligase, C-terminal (Domain)
 [314-447]  3.59998852907783e-40 SSF53244
SSF53244   Mur_ligase_C
 [317-393]  5.29999999999999e-16 PF02875
PF02875   Mur_ligase_C
 [314-446]  1.99999999999999e-43 G3DSA:3.90.190.20
G3DSA:3.90.190.20   Mur_ligase_C
IPR005863 UDP-MurNAc-pentapeptide synthetase (Family)
 [32-446]  7.59999999999998e-123 TIGR01143
TIGR01143   MurF
IPR013221 Mur ligase, central (Domain)
 [101-312]  1.60000240695997e-53 SSF53623
SSF53623   Mur_ligase_cen
 [88-310]  3.29999999999997e-61 G3DSA:3.40.1190.10
G3DSA:3.40.1190.10   Mur_ligase_cen
 [107-294]  2.1e-41 PF08245
PF08245   Mur_ligase_M
SignalP No significant hit
TMHMM No significant hit