close all open/close all

CDS information : Teicp2_00140


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction16,198 / 15,659 / - [in whole cluster]
16,198 / 15,659 / - [in contig]
Locationcomplement(15659..16198) [in whole cluster]
complement(15659..16198) [in contig]
TypeCDS
Length540 bp (179 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tcp5
EC number
Keyword
Note
Note (GenBank)
  • similar to P. aeruginosa hypothetical protein AE004768
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)
Related Reference
ACC
Q6ZZK0
NITE
Teicp_00080
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSDVSGAGKVVVNRAMSLDGFIAGPGHAMDWIFEYLTGDMFPEVMASTGAMLIGRGTYEV
AKRMAGQGTPYDGGAQFVLTHEPPHEPDPAVTFLSCDIEEAVATARSAAGGKNLEILGAD
VAAQCLRRGLVDEILVYVVPVLLGDGVRFSPPSLDRIDLEPLSNTRSGAVTMLRFRVRK
selected fasta
>hypothetical protein [hypothetical protein]
ATGAGCGATGTGAGCGGCGCCGGCAAAGTGGTCGTGAACAGGGCGATGTCGCTGGACGGG
TTCATCGCCGGTCCCGGCCACGCGATGGACTGGATCTTCGAATACCTGACTGGGGACATG
TTCCCGGAGGTTATGGCGTCCACGGGCGCCATGCTCATCGGCCGAGGCACGTACGAGGTC
GCCAAGCGTATGGCCGGCCAGGGCACCCCCTACGACGGGGGAGCACAGTTCGTCCTCACG
CACGAGCCTCCCCACGAGCCGGACCCTGCCGTCACGTTCCTCAGCTGTGACATCGAGGAA
GCCGTTGCCACGGCACGCAGCGCCGCGGGCGGCAAGAACTTGGAAATCCTCGGTGCTGAC
GTGGCCGCCCAGTGCCTGCGGCGCGGGCTCGTCGACGAGATCCTGGTGTATGTCGTACCG
GTGCTGCTCGGCGACGGTGTCCGCTTCTCGCCCCCAAGCCTCGACAGGATCGACCTGGAA
CCTCTCAGCAACACCCGGTCCGGCGCCGTCACGATGCTGCGCTTCCGCGTGCGAAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002734 Bacterial bifunctional deaminase-reductase, C-terminal (Domain)
 [9-160]  3.09999999999998e-17 PF01872
PF01872   RibD_C
IPR024072 Dihydrofolate reductase-like domain (Domain)
 [9-178]  4.5e-33 G3DSA:3.40.430.10
G3DSA:3.40.430.10   G3DSA:3.40.430.10
 [8-178]  2.39999798157265e-29 SSF53597
SSF53597   SSF53597
SignalP No significant hit
TMHMM No significant hit