close all open/close all

CDS information : Teicp2_00150


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction17,402 / 16,311 / - [in whole cluster]
17,402 / 16,311 / - [in contig]
Locationcomplement(16311..17402) [in whole cluster]
complement(16311..17402) [in contig]
TypeCDS
Length1,092 bp (363 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)transmamebrane sensor kinase
Genetcp6
vanS
Gene (GenBank)tcp6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)
Related Reference
ACC
Q6ZZJ9
NITE
Teicp_00090
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q9X942
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)
[20383152] A vancomycin photoprobe identifies the histidine kinase VanSsc as a vancomycin receptor. (Nat Chem Biol. , 2010)
[23836175] In vivo studies suggest that induction of VanS-dependent vancomycin resistance requires binding of the drug to D-Ala-D-Ala termini in the peptidoglycan cell wall. (Antimicrob Agents Chemother. , 2013)

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [transmamebrane sensor kinase]
MDRAPGLSVRLKLTLSYAGFLMLAGASLLATVWVYLLRGLPDTAMSSRGLVPIKTIVLHA
FAPATAGVLLFLLVFGLLGGWLLAGRMLAPLTRITEATRMAANGSLSHRIELDGRKDEFR
ELADAFDIMLTRLEAHIAEHQRFAANASHELRTPLAITKTLLDVARTDPARSTHELIGRL
HTVNTRAIDLTEALLLLSRADRRSFKREYVDLSLNVEEAIETLLPLAEKHGVTIEASGDI
TPTVGSRALLLQMTINLLHNAIVHNVAEERIVWVTTSVHPKSVTLTVENTGEQLSAQLVS
TLTEPFQRGTERIHHDHAGVGLGLAIVKSIAHAHDGTLTTAPRAGGGLHVTVQLPAATTP
PRN
selected fasta
>putative two-component system histidine kinase [transmamebrane sensor kinase]
GTGGACCGAGCCCCCGGCTTGAGCGTGCGCCTCAAACTCACGTTGAGCTACGCCGGCTTC
CTCATGCTCGCCGGCGCCTCGTTGCTCGCCACCGTGTGGGTGTACCTCCTGCGCGGCCTA
CCGGACACCGCGATGAGCAGTCGTGGTCTCGTGCCCATCAAGACCATCGTCTTGCACGCC
TTCGCCCCGGCGACGGCCGGAGTCCTGCTGTTCCTACTGGTGTTCGGCCTGCTCGGCGGG
TGGCTTCTGGCCGGTCGGATGCTCGCTCCTCTGACCCGCATCACAGAGGCCACCCGCATG
GCCGCGAACGGTTCGCTCTCGCACCGCATCGAGTTGGATGGCCGCAAGGATGAGTTCCGC
GAGCTCGCCGACGCCTTCGACATCATGCTGACGCGACTCGAAGCACACATCGCCGAGCAC
CAGAGATTCGCAGCCAACGCCTCTCACGAGCTGCGTACGCCGCTGGCGATCACGAAAACG
CTTCTCGACGTCGCCCGCACCGACCCGGCACGAAGCACCCACGAGCTCATCGGTCGCCTT
CACACCGTCAACACCCGGGCAATCGACCTCACCGAGGCACTGCTTCTGCTGAGCCGCGCC
GACCGGCGATCGTTCAAGCGCGAGTATGTCGACCTGTCGCTGAACGTCGAAGAAGCCATC
GAGACGCTCCTACCGCTGGCGGAGAAGCACGGCGTCACCATCGAAGCCTCCGGCGACATC
ACCCCGACCGTCGGCTCACGTGCCCTGCTGTTACAAATGACGATCAACCTCTTGCACAAC
GCGATCGTGCATAACGTGGCGGAAGAGCGCATCGTGTGGGTCACGACCAGCGTCCATCCC
AAGAGTGTGACCCTCACCGTGGAAAACACCGGCGAGCAGCTCTCCGCACAGCTGGTCTCG
ACACTCACCGAACCGTTCCAGCGCGGCACCGAGCGCATACACCACGATCATGCAGGTGTC
GGCCTCGGCCTGGCGATCGTCAAGAGCATCGCCCACGCGCACGACGGAACACTCACCACC
GCCCCGCGCGCTGGAGGCGGCCTGCACGTCACGGTGCAGCTGCCAGCCGCGACAACGCCT
CCGAGAAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [204-360]  7.20000000000003e-29 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [249-356]  2.7e-17 PF02518
PF02518   HATPase_c
 [204-359]  9.00000407957278e-33 SSF55874
SSF55874   ATP_bd_ATPase
 [245-358]  3.60000433965927e-22 SM00387
SM00387   HATPase_c
IPR003660 HAMP linker domain (Domain)
 [85-138]  PS50885
PS50885   HAMP
 [85-138]  6.899999633797e-15 SM00304
SM00304   HAMP
 [67-134]  1.4e-17 PF00672
PF00672   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [139-203]  1.19999985703101e-08 SM00388
SM00388   HisKA
 [141-202]  3.8e-07 PF00512
PF00512   HisKA
IPR004358 Signal transduction histidine kinase-related protein, C-terminal (Domain)
 [283-297]  1e-07 PR00344 [318-336]  1e-07 PR00344 [342-355]  1e-07 PR00344
PR00344   BCTRLSENSOR
IPR005467 Signal transduction histidine kinase, core (Domain)
 [146-358]  PS50109
PS50109   HIS_KIN
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [121-205]  2.19999900980708e-13 SSF47384
SSF47384   His_kin_homodim
SignalP No significant hit
TMHMM
 [15-37]  Transmembrane (o-i) [57-79]  Transmembrane (i-o)
Transmembrane 2