close all open/close all

CDS information : Teicp2_00160


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction18,090 / 17,410 / - [in whole cluster]
18,090 / 17,410 / - [in contig]
Locationcomplement(17410..18090) [in whole cluster]
complement(17410..18090) [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)response regulator
Genetcp7
vanR
Gene (GenBank)tcp7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)
Related Reference
ACC
Q6ZZJ8
NITE
Teicp_00100
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q8CJW1
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)
ACC
Q799B5
NITE
Balhi_00020
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)

close this sectionSequence

selected fasta
>putative two-component system response regulator [response regulator]
MRVLIVEDEPYMAEAIRDGLRLEAIAADIAGDGDTALEMLSVNAYDIVILDRDIPGTSGD
QIAERIVASRSGMPILMLTAADRLDDKASGFELGADDYLTKPFELRELVLRLRALDRRRA
YSRPPVREIAGLRLDPFRREVYRDDRYVALTRKQFAVLAVLVAAEGGVVSAEELLERAWD
ENADPFTNAVRITVSALRKRLGEPQIIATVPGVGYRITTQPGSGRA
selected fasta
>putative two-component system response regulator [response regulator]
ATGCGCGTATTGATCGTCGAGGACGAACCCTACATGGCGGAGGCTATCCGGGATGGCCTC
CGTTTGGAAGCGATCGCGGCAGACATCGCCGGTGACGGTGACACCGCTCTGGAAATGCTG
AGCGTGAACGCCTACGACATCGTCATCCTCGACCGCGACATCCCCGGCACCTCGGGTGAT
CAGATCGCCGAACGCATCGTCGCCTCCCGGAGCGGTATGCCCATCCTCATGCTCACCGCT
GCCGATCGGCTCGACGACAAAGCATCCGGGTTCGAGCTCGGCGCCGACGACTACCTCACC
AAGCCGTTCGAACTGCGGGAGCTCGTGCTCAGGCTCAGGGCACTCGACCGCAGGCGCGCC
TACAGCAGGCCACCTGTACGGGAGATCGCGGGCCTGCGACTGGACCCGTTCCGCCGCGAG
GTCTACCGCGACGACCGCTACGTCGCGCTGACCCGGAAGCAGTTCGCCGTGCTCGCCGTC
CTCGTAGCCGCCGAAGGCGGCGTCGTCAGCGCCGAGGAACTGCTGGAACGGGCTTGGGAC
GAGAACGCGGACCCGTTCACCAACGCCGTCCGCATCACCGTTTCGGCCCTGCGCAAACGG
CTCGGCGAGCCCCAGATCATCGCCACCGTGCCCGGCGTCGGGTATCGCATAACCACGCAA
CCAGGCAGCGGGCGTGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [1-112]  8.30001403791594e-34 SM00448
SM00448   REC
 [2-116]  PS50110
PS50110   RESPONSE_REGULATORY
 [3-112]  8.80000000000003e-24 PF00072
PF00072   Response_reg
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [147-217]  1e-18 PF00486
PF00486   Trans_reg_C
 [145-217]  2.10000267834031e-22 SM00862
SM00862   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-187]  2.90000354677981e-35 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [125-218]  3.2e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit