close all open/close all

CDS information : Teicp2_00170


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction18,949 / 20,130 / + [in whole cluster]
18,949 / 20,130 / + [in contig]
Location18949..20130 [in whole cluster]
18949..20130 [in contig]
TypeCDS
Length1,182 bp (393 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
UDP-N-acetyl-glucosamine transferase
Product (GenBank)GtfA protein
Genetcp8
tgtfA
Gene (GenBank)tcp8
EC number
Keyword
  • Bht6
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[17661468] Kinetic analysis of teicoplanin glycosyltransferases and acyltransferase reveal ordered tailoring of aglycone scaffold to reconstitute mature teicoplanin. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q6ZZJ7
NITE
Teicp_00110
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>glycosyltransferase [GtfA protein]
MRVLFSSYGTRGDVEPLVALAVRLRELGAEVRMCASPDYVERLAEVEVPMVPIGQPVRAG
ARKGAAPPGAPEAVAEVIAEQFDRVPPFAEGCDAVVASGLVSTAVAVRSVAEKLGIHHYA
YAVLSPSFLRAPGVTDSRDLRARANQGAYRQFGGPLNSHRAAVGLPPVEKVIDYAFTERP
WLAADPVLDPLRPTDPDVVQTGAWILPDQRPLSAELEGFLRAGSPPVYVGFGSGPAPAEA
ARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLFGRVAAVVHHGGAGTT
TAVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTPTVESLSAALATALTPGIRAR
AAAVAGTIRTDGTTVAAKLLLEAISRQRSSVPA
selected fasta
>glycosyltransferase [GtfA protein]
ATGCGCGTGCTGTTTTCGTCCTACGGGACACGCGGAGATGTCGAGCCCCTGGTGGCATTG
GCCGTGCGACTGCGGGAACTCGGTGCGGAGGTCCGGATGTGCGCGTCGCCGGACTACGTG
GAGCGGCTGGCCGAGGTCGAAGTGCCGATGGTGCCGATCGGCCAGCCGGTGCGCGCGGGG
GCCCGCAAGGGTGCAGCGCCTCCGGGGGCGCCCGAGGCCGTGGCCGAGGTGATCGCCGAG
CAGTTCGACAGGGTCCCGCCGTTCGCCGAAGGGTGTGACGCGGTGGTGGCCAGCGGTCTG
GTGTCCACCGCCGTCGCCGTGCGGTCGGTCGCCGAGAAGCTGGGCATCCACCACTACGCC
TACGCCGTGCTCTCGCCGTCCTTTCTGCGCGCGCCCGGCGTGACCGACAGCCGGGACCTG
CGGGCCCGGGCCAACCAGGGCGCCTATCGACAGTTCGGTGGCCCGCTCAACAGCCATCGG
GCCGCGGTCGGCCTGCCGCCGGTGGAGAAGGTCATCGACTACGCCTTCACCGAGCGCCCC
TGGTTGGCGGCGGACCCGGTCCTGGACCCGCTGCGGCCGACGGACCCGGACGTGGTGCAG
ACCGGCGCGTGGATCCTGCCCGACCAGCGGCCGTTGTCGGCGGAGTTGGAGGGGTTCTTG
AGGGCTGGCTCGCCTCCGGTGTACGTGGGTTTCGGCAGTGGGCCGGCGCCTGCCGAGGCC
GCGCGGGTGGCCATCGAGGCGGTTCGGGCTCAGGGCCGCCGGGTGGTGCTGTCCAGTGGT
TGGGCCGGGTTGGGCCGGATCGACGAGGGGGATGACTGTCTGGTGGTGGGCGAGGTGAAC
CATCAGGTGCTGTTCGGCCGGGTGGCCGCCGTCGTCCACCACGGCGGGGCGGGCACGACG
ACCGCGGTGACCCGGGCGGGCGCTCCGCAGGTCGTGGTGCCCCAGAAGGCGGATCAGCCC
TACTATGCCGGTCGGGTGGCTGACCTGGGTGTCGGCGTGGCGCATGACGGTCCGACCCCG
ACCGTCGAGTCCCTGTCCGCGGCGCTGGCCACGGCGTTGACCCCGGGGATCCGGGCGCGA
GCGGCGGCGGTGGCCGGCACGATCCGCACCGACGGGACGACGGTGGCCGCGAAACTGCTC
CTCGAGGCGATCAGCCGGCAGAGATCGTCGGTTCCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-118]  4.5e-23 PF03033
PF03033   Glyco_transf_28
IPR007235 Glycosyl transferase, family 28, C-terminal (Domain)
 [290-358]  0.00014 PF04101
PF04101   Glyco_tran_28_C
SignalP No significant hit
TMHMM No significant hit