close all open/close all

CDS information : Teicp2_00180


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction20,622 / 26,852 / + [in whole cluster]
20,622 / 26,852 / + [in contig]
Location20622..26852 [in whole cluster]
20622..26852 [in contig]
TypeCDS
Length6,231 bp (2,076 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase
Gene
Gene (GenBank)tcp9
EC number
Keyword
Note
Note (GenBank)
  • contains Modules 1 (Adenylation and Thiolation domains) and 2 (Condensation, Adenylation, Thiolation and Epimerization domains)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZJ6
NITE
Teicp_00120
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

A1 L-4-hydroxyphenylglycine(Hpg)
2 tyrosine
A36..426
PCP502..568
C601..890
A1057..1447
PCP1522..1588
E1627..2062

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
MNSAAQATSTVPELLARQVTRAPDAVAVVDRDRVLTYRELDELAGRLSGRLIGRGVRRGD
RVAVLLDRSADLVVTLLAIWKAGAAYVPVDAGYPAPRVAFMVADSGASRMVCSAATRDGV
PEGIEAIVVTDEEAFEASAAGARPGDLAYVMYTSGSTGIPKGVAVPHRSVAELAGNPGWA
VEPGDAVLMHAPYAFDASLFEIWVPLVSGGRVVIAEPGPVDARRLREAISSGVTRAHLTA
GSFRAVAEESPESFAGLREVLTGGDVVPAHAVARVRSACPRVRIRHLYGPTETTLCATWH
LLEPGDEIGPVLPIGRPLPGRRAQVLDASLRAVAPGVIGDLYLSGAGLADGYLRRAGLTA
ERFVADPSAPGARMYRTGDLAQWTADGALLFAGRADDQVKVRGFRIEPAEVEAALTAQPG
VHEAVVRAVDGRLVGYVVAEGDAEPAVLRERVGAVLPEYMVPAAVITLDALPLTGNGKVD
RAALPAPVFAADAPGREPGTEAERVLCGLLSEVLGLNRVGVDESFFELGGDSIAAIRLAA
RASRAGLLVTPAQIFKERTVARLAAVAGAVPAGPPVDRPLIALTAEEEVELAAAVPGAVE
VWPLAPLQEGLLFQSTIDTEGLDIYQAQWILQLNAPLDVRRLRVAWEAVFARHAELRVSF
VRLASGKTVQAAAGHVVLPWREVDLTDAGDVDAALQELAGREQEQRFDLARAPLFRLVLV
RYGEDRHRLLVVHHHILTDGWSVAVILNEVAEAYAAGGRLPDRTGPVSYRNYLAWLDRQD
REAARAAWRAELSGLDEPVPIARAAAGTGYEYRVAFLPADVCTRLTASVRDHGLTLNTVV
QGAWAMVLSRLVRRTDVVFGTTVAVRPAELPGVESIPGLMMNTVPVRVTLDGGQSLLDLL
TGLQRRQAALMPHQHLGLPEIQRTAGPGATFDTLLVFENYPRDFAGQFTYLGTIEGTHYP
LTLGIIPGERLRIQLAYRHGQIEETLAASVLDGFVAALRAVAADPSGLVGRTGVGRGPVH
GLAPALVAAESLPVLVGRVVEQRSHEVAVVDGDGELSFGQLWDQAVGLADLLTARGVGPE
CRVGVLVGRSAWWVVGMLGVSLAGGAFVPVDPAYPAERIRLILADADPALVVCAGKTREA
VPAAFADRLLVVDEMDLTGGSAARLPRVRPGDAAYVIYTSGSTGRPKGVVVPHAGLGNLA
LAQIDRFGVSPSSRVLQFAALGFDAMVSEVLMALLSGARLVMAPEHQLPPRVSLAEALQR
WDVTHVTVPPSVLATAEALPARLETVVVAGEACPPSLADRWSAGLRLVNAYGPTEATVCA
AMSMPLVASRPVVPIGTPIAGGRCYVLDAFLRPLPPGLTGELYVAGIGLARGYLGRAALT
AERFVADPFVPGERMYRTGDLAYRTGEGELVFAGRADDQVKVRGFRIEPGEVESALSGHP
GVAQAAVIVRGDRLLAYVSPAGVDPQAVREDLASRLPPYMVPAVVVPLEALPTTPNGKID
RGALPDPDFAAGADVREPRTEVERALCDLFAEVLGLDRVGVTDSFFEVGGDSITSMQLVA
RARRAGLTFAAHDVFEERTPERLAQVAAQAPRPERGHMIGDGVGEVARTPVMRLLGDAVV
AAGFAQWVVVAVPAGLGERALVAALTAVVDAHDMLRVRVDSGRLVVRARGSVDVAGAVER
VEADTGEIDEVARRCAVAVAARLDPAAGVVVRAAWVDAGPDRSGRLVLAAHHLAVDGVSW
RVLVPDLQAACEAVAAGRQPALEPVGVSFRRWADLLGQWAVSPERVGELARWRAVVGSGD
RRIGEPGPSAGAVRSRSWVVSGSRAQVLVGRAPVVFFCGVHEVVLAGLAGAVARWHGGDV
VLVDVEGHGRHPVGGLDLSRTVGWFTSVHPVRLDVAGIDWAGVLAGGPAAGELLKRVKEQ
SRAVPGDGLGYGLLRFLNDETGPVLAALPSPQIGFNFMGRHVAGVREWQPVGDVGGALGP
GVGLPHVLDADAVVEDGPRGPLLRLVLSWPDGVLREDEVERLGRGWSDMLSGLAGQADDP
SAGGHTASDFDLLDLDQDEIENFEAIAAEFGGGQES
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
ATGAATTCCGCAGCGCAGGCCACATCGACGGTGCCGGAGCTGCTCGCCCGGCAGGTGACC
CGGGCCCCCGATGCGGTGGCCGTGGTGGACCGGGACCGGGTTCTGACGTACCGGGAACTC
GATGAGCTCGCGGGCCGGTTGTCCGGACGTCTGATCGGCCGGGGCGTCCGCCGCGGGGAC
CGCGTGGCGGTCCTGCTGGACCGTTCGGCGGACCTGGTGGTGACGCTGCTCGCGATCTGG
AAGGCCGGGGCGGCGTATGTGCCGGTCGATGCCGGCTATCCCGCGCCGCGTGTGGCGTTC
ATGGTGGCGGACTCGGGAGCCTCCCGCATGGTGTGCTCGGCCGCGACGCGTGACGGCGTA
CCGGAGGGGATCGAGGCGATCGTCGTCACGGATGAGGAGGCGTTCGAGGCCTCGGCGGCC
GGGGCGCGACCGGGAGATCTGGCGTACGTGATGTACACCTCCGGCTCGACCGGCATCCCG
AAGGGCGTGGCGGTTCCGCATCGCAGCGTCGCGGAGCTGGCCGGGAATCCCGGCTGGGCG
GTGGAGCCGGGCGACGCGGTCCTGATGCACGCGCCGTACGCCTTCGACGCGTCGCTGTTC
GAGATCTGGGTGCCGCTGGTTTCCGGGGGCCGGGTGGTGATCGCCGAGCCGGGGCCGGTG
GACGCCCGGCGCCTGCGGGAGGCGATCAGCTCCGGGGTGACCAGGGCGCATCTGACCGCC
GGCAGCTTCCGCGCGGTGGCGGAGGAGTCGCCGGAGTCCTTCGCCGGGCTGCGCGAGGTG
CTGACCGGCGGTGACGTGGTGCCGGCACACGCCGTGGCGCGGGTCCGCTCGGCCTGTCCC
CGGGTGCGGATCCGGCACCTGTACGGCCCGACGGAGACGACGCTGTGCGCCACATGGCAT
CTTCTGGAGCCGGGGGACGAGATCGGCCCGGTGTTGCCGATCGGCCGTCCGCTCCCGGGC
CGGCGCGCTCAGGTGCTCGACGCGTCGCTGCGGGCCGTGGCGCCGGGCGTGATCGGTGAC
CTGTACCTGTCCGGCGCCGGTCTGGCTGACGGCTACCTGCGCCGGGCAGGGCTGACAGCG
GAGCGATTCGTGGCCGACCCGTCCGCGCCCGGGGCGAGGATGTACCGCACCGGCGACCTC
GCGCAGTGGACCGCCGACGGTGCGTTGCTGTTCGCGGGCCGGGCCGACGACCAGGTGAAG
GTTCGCGGCTTCCGGATCGAGCCGGCCGAGGTCGAGGCCGCGTTGACCGCGCAGCCGGGC
GTCCACGAGGCCGTGGTCCGAGCGGTCGACGGGCGCCTGGTCGGCTATGTGGTGGCGGAG
GGGGACGCGGAACCGGCTGTCCTGCGCGAGCGTGTCGGTGCGGTGCTGCCGGAGTACATG
GTCCCGGCCGCGGTGATCACACTGGACGCGCTGCCGCTGACCGGCAACGGCAAGGTGGAC
CGGGCGGCTCTGCCGGCTCCGGTCTTCGCGGCGGACGCTCCGGGGCGCGAACCCGGCACC
GAGGCGGAGCGCGTGCTGTGCGGGCTGCTGTCCGAGGTGCTCGGCCTGAACCGGGTCGGA
GTCGACGAGAGCTTCTTCGAGCTGGGCGGAGACTCCATCGCGGCGATCCGGCTGGCGGCG
CGTGCGTCCCGGGCGGGCCTGCTCGTGACGCCCGCCCAGATCTTCAAGGAGAGGACTGTC
GCACGGCTGGCGGCCGTGGCGGGCGCTGTACCGGCCGGGCCACCCGTCGACCGCCCCCTC
ATCGCGCTGACCGCGGAGGAGGAGGTCGAGCTGGCGGCCGCCGTCCCGGGCGCGGTGGAG
GTCTGGCCGCTGGCACCGCTGCAGGAGGGGTTGCTCTTCCAGTCGACCATCGACACCGAG
GGCCTCGACATCTACCAGGCGCAGTGGATTCTCCAGCTGAACGCGCCGCTGGACGTGCGC
CGGCTACGGGTCGCGTGGGAAGCGGTCTTCGCGCGGCACGCCGAGCTTCGAGTGAGCTTC
GTCCGGCTGGCGTCCGGGAAGACGGTGCAGGCCGCCGCCGGGCACGTCGTCCTGCCGTGG
CGGGAGGTGGATCTGACCGATGCGGGCGATGTCGACGCGGCCCTGCAGGAGCTGGCCGGG
CGGGAGCAGGAACAGCGCTTCGACCTTGCCCGCGCGCCGTTGTTCCGGTTGGTGCTGGTC
CGGTACGGCGAGGACCGGCACCGGCTGCTGGTCGTCCATCACCACATCCTGACCGACGGT
TGGTCGGTGGCGGTCATCCTCAACGAGGTGGCCGAGGCCTATGCGGCCGGTGGGCGGCTG
CCCGACCGGACGGGTCCGGTGTCCTATCGGAACTACCTGGCCTGGCTGGACCGGCAGGAC
AGGGAGGCGGCGCGCGCGGCCTGGCGGGCCGAGCTGTCCGGCCTCGACGAGCCCGTGCCG
ATCGCCAGGGCGGCCGCCGGGACCGGGTACGAATACCGTGTCGCGTTCCTGCCGGCGGAT
GTCTGCACGAGGCTGACGGCGTCGGTCCGTGACCACGGGCTGACGCTGAACACGGTGGTG
CAGGGCGCGTGGGCGATGGTGCTGTCGCGACTTGTCCGGCGTACCGATGTGGTATTCGGC
ACCACGGTGGCCGTCCGTCCCGCGGAGCTCCCGGGCGTGGAGTCGATACCGGGCCTGATG
ATGAACACGGTGCCGGTCCGGGTGACGCTGGACGGTGGGCAATCGCTCCTCGACCTGCTC
ACCGGCCTGCAGCGGCGGCAGGCGGCCCTGATGCCGCACCAGCATCTGGGGCTGCCGGAG
ATCCAGAGGACGGCCGGGCCGGGCGCGACGTTCGACACGCTGCTGGTGTTCGAGAACTAC
CCGCGGGATTTCGCCGGCCAGTTCACCTACCTGGGCACGATCGAGGGGACGCACTATCCG
CTCACCCTCGGCATCATCCCGGGAGAGCGTCTCAGGATCCAGCTCGCCTACCGGCACGGG
CAGATCGAGGAGACCCTCGCCGCGTCGGTCCTGGACGGGTTCGTCGCAGCTCTCCGCGCG
GTGGCCGCCGACCCGTCCGGGTTGGTGGGCCGGACCGGTGTGGGCCGCGGCCCGGTGCAC
GGCTTAGCCCCGGCACTGGTGGCGGCGGAGTCGCTGCCCGTGCTGGTGGGGCGGGTGGTG
GAGCAGCGGTCGCACGAGGTGGCCGTGGTGGACGGCGACGGCGAACTGTCCTTCGGGCAG
TTGTGGGACCAGGCGGTGGGCTTGGCGGACCTGCTGACGGCACGTGGAGTGGGACCCGAG
TGCCGGGTGGGTGTGCTGGTGGGGCGGTCGGCGTGGTGGGTGGTCGGGATGCTGGGCGTC
TCGCTGGCGGGTGGCGCCTTCGTCCCGGTGGATCCGGCGTACCCGGCCGAACGCATCCGG
CTGATCCTGGCCGACGCCGATCCCGCGCTCGTGGTGTGTGCGGGGAAGACCCGCGAGGCG
GTGCCCGCGGCGTTCGCGGATCGGCTGCTGGTGGTCGACGAGATGGATCTGACCGGGGGA
TCGGCGGCTCGATTGCCGCGGGTACGTCCGGGTGACGCGGCATATGTGATCTATACGTCG
GGGTCGACGGGCAGGCCGAAGGGGGTCGTCGTCCCGCACGCGGGACTGGGGAACCTGGCG
CTGGCGCAGATCGACCGGTTCGGTGTGTCGCCGTCGTCCCGGGTCCTGCAGTTCGCGGCG
CTGGGCTTCGACGCGATGGTGTCGGAAGTGTTGATGGCGTTGCTGTCCGGGGCGCGGCTG
GTGATGGCGCCGGAACACCAGCTGCCGCCGCGCGTGTCGCTGGCCGAGGCGCTGCAGCGG
TGGGATGTCACGCACGTGACCGTTCCGCCGTCGGTGCTGGCCACGGCGGAGGCGTTGCCG
GCCCGGCTGGAGACCGTGGTGGTGGCCGGGGAGGCATGTCCGCCAAGCCTGGCGGACCGC
TGGTCGGCGGGTCTGCGGCTGGTCAATGCGTACGGGCCCACCGAGGCCACGGTGTGCGCG
GCGATGAGCATGCCGCTGGTGGCGAGCCGGCCCGTGGTCCCGATCGGGACGCCGATCGCC
GGGGGACGCTGCTATGTGCTGGACGCGTTCCTGCGGCCGCTGCCGCCGGGCCTCACCGGT
GAGCTGTACGTGGCCGGGATCGGGCTGGCTCGCGGGTATCTGGGACGGGCCGCGTTGACG
GCCGAGCGGTTCGTCGCCGACCCGTTCGTCCCGGGTGAGCGGATGTACCGGACCGGAGAT
CTGGCGTACCGGACCGGCGAGGGTGAGCTGGTGTTCGCCGGGCGTGCCGACGACCAGGTG
AAGGTTCGTGGATTCCGGATCGAGCCCGGTGAGGTCGAGTCGGCCCTGTCCGGTCACCCC
GGGGTTGCCCAAGCCGCGGTGATCGTGCGCGGTGACCGCCTACTGGCCTATGTGTCGCCG
GCTGGCGTCGATCCGCAGGCGGTGCGCGAAGACCTCGCATCGCGGTTGCCGCCGTACATG
GTGCCCGCGGTGGTGGTGCCGCTGGAGGCGTTGCCCACCACCCCGAACGGGAAGATCGAC
CGGGGCGCGCTGCCTGATCCCGACTTCGCGGCCGGGGCAGATGTCCGGGAGCCGCGCACC
GAGGTCGAGCGGGCGTTGTGCGATCTCTTCGCCGAGGTGCTCGGTCTGGACCGGGTCGGC
GTCACCGACAGCTTCTTCGAGGTGGGCGGCGACTCCATCACCTCGATGCAGTTGGTGGCA
CGGGCCCGGCGTGCGGGTCTGACGTTCGCCGCGCACGACGTGTTCGAGGAGCGGACCCCG
GAGCGGCTCGCGCAGGTGGCGGCGCAGGCGCCGCGGCCGGAACGCGGCCACATGATCGGC
GACGGTGTGGGCGAGGTGGCGCGGACGCCGGTCATGCGGTTGCTGGGCGATGCGGTGGTG
GCCGCGGGATTCGCGCAGTGGGTCGTGGTCGCCGTGCCCGCAGGGCTCGGGGAGCGCGCG
TTGGTGGCGGCGTTGACGGCGGTGGTGGACGCGCACGACATGCTGCGGGTGCGGGTGGAC
TCGGGGCGGTTGGTGGTGCGCGCCCGTGGGTCGGTCGATGTGGCCGGTGCGGTGGAGCGG
GTCGAGGCCGACACCGGCGAGATCGACGAGGTGGCGCGTCGCTGTGCGGTGGCGGTGGCC
GCACGGCTGGACCCCGCTGCCGGTGTGGTGGTGCGGGCGGCGTGGGTGGACGCCGGCCCG
GATCGCTCCGGCCGCTTGGTGCTGGCCGCGCATCACCTGGCCGTCGACGGAGTGTCGTGG
CGTGTTCTGGTACCGGACCTGCAGGCGGCGTGTGAGGCGGTGGCCGCCGGGCGGCAGCCG
GCCCTGGAACCGGTGGGAGTGTCGTTCCGGCGGTGGGCGGACCTGTTGGGGCAGTGGGCG
GTTTCGCCGGAGCGGGTGGGGGAGTTGGCGCGATGGCGGGCGGTGGTGGGTTCCGGGGAC
CGGCGGATCGGTGAGCCCGGCCCGTCCGCCGGGGCCGTGCGTTCCCGCTCGTGGGTGGTG
TCGGGGTCACGGGCTCAGGTGCTGGTGGGACGCGCGCCGGTGGTGTTCTTCTGCGGGGTC
CATGAGGTCGTGCTGGCCGGACTGGCGGGCGCGGTGGCACGGTGGCACGGCGGGGATGTG
GTCCTGGTCGATGTCGAGGGTCACGGCCGTCACCCGGTGGGCGGACTGGACCTGTCCCGG
ACGGTGGGTTGGTTCACCAGCGTCCACCCGGTGCGGCTGGATGTCGCCGGCATCGACTGG
GCGGGCGTGCTGGCCGGTGGACCGGCGGCCGGGGAGCTGTTGAAAAGGGTCAAGGAGCAG
TCGCGGGCGGTGCCCGGCGACGGGCTCGGTTACGGGTTGCTGCGTTTTCTCAACGACGAG
ACGGGCCCGGTACTGGCGGCGTTGCCATCGCCGCAGATCGGATTCAACTTCATGGGACGG
CATGTGGCCGGTGTGCGGGAGTGGCAGCCGGTCGGGGATGTGGGCGGCGCGCTGGGCCCG
GGCGTCGGGTTGCCGCATGTCCTCGACGCCGACGCGGTGGTCGAGGACGGCCCCCGGGGC
CCGCTGCTGAGGTTGGTGCTGAGCTGGCCGGACGGTGTGCTGCGGGAGGACGAGGTCGAG
CGGCTGGGCCGCGGTTGGTCGGACATGTTGTCCGGACTGGCCGGCCAGGCAGATGATCCG
TCGGCGGGGGGACACACCGCGTCCGATTTCGACCTCCTCGACCTGGACCAGGACGAGATC
GAGAACTTCGAAGCAATAGCGGCCGAATTCGGTGGAGGTCAGGAATCGTGA
[1] A36..426
[1] L-4-hydroxyphenylglycine(Hpg)196..296
[1] PCP502..568
[2] C601..890
[2] A1057..1447
[2] tyrosine1224..1319
[2] PCP1522..1588
[2] E1627..2062
[1] A106..1278
[1] L-4-hydroxyphenylglycine(Hpg)586..888
[1] PCP1504..1704
[2] C1801..2670
[2] A3169..4341
[2] tyrosine3670..3957
[2] PCP4564..4764
[2] E4879..6186

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-426]  4.80000000000003e-105 PF00501 [1057-1447]  6.10000000000004e-110 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [601-890]  1.2e-55 PF00668 [1627-1895]  9.60000000000003e-27 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [527-542]  PS00012 [1547-1562]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [502-568]  PS50075 [1522-1588]  PS50075
PS50075   ACP_DOMAIN
 [505-565]  6.3e-11 PF00550 [1525-1585]  2.9e-11 PF00550
PF00550   PP-binding
 [495-569]  1.29999924468179e-15 SSF47336 [1515-1589]  8.1000073432326e-19 SSF47336
SSF47336   ACP_like
 [491-567]  1.70000000000001e-49 G3DSA:1.10.1200.10 [1512-1590]  1.70000000000001e-49 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1910-2062]  4.10000000000001e-31 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [36-426]  1.60000000000002e-124 TIGR01733 [1057-1447]  5.20000000000001e-125 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [150-161]  PS00455 [1176-1187]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit