close all open/close all

CDS information : Teicp2_00240


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction49,293 / 51,074 / + [in whole cluster]
49,293 / 51,074 / + [in contig]
Location49293..51074 [in whole cluster]
49293..51074 [in contig]
TypeCDS
Length1,782 bp (593 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative mannosyltransferase
Product (GenBank)putative mannosyltransferase
Gene
Gene (GenBank)tcp15
EC number2.4.1.-
Keyword
  • Dpg7
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZJ0
NITE
Teicp_00180
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q7WZ71
NITE
A4092_00260
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
PmId
[23892980] Functional identification of the gene encoding the enzyme involved in mannosylation in ramoplanin biosynthesis in Actinoplanes sp. (Biotechnol Lett. , 2013)
[25878261] Engineered biosynthesis of enduracidin lipoglycopeptide antibiotics using the ramoplanin mannosyltransferase Ram29. (Microbiology. , 2015)

close this sectionSequence

selected fasta
>putative mannosyltransferase [putative mannosyltransferase]
MVSETLTHPPSQDSAPESRPHRWAVWRSPAGQPAWARPALLGIALVAAVLYAWNLRLVDY
APRYADAVKSMSGSWRAFLYGAVDPEATYTLDKLAGSFVPQVVSAKIFGYHAWSLALPQV
IEGVIAVLVMYRVVRRWVGVVPGLLAAGIFTLTPVAASMFGHSMEDGALVMCLVLAVDAY
QRAVLEGRLRSLIGAGVWVGLGFQAKMVQAWMILPALAVGYLLTAPIELRRRVRHLGAAG
AVMLAVSLSWVMLYTLTPASDRPYISGTTNNNAFAMVFGYNGLGRVGINLPGAEEVNGRN
GVPAPGPLGGPEGEGQRGTVGTKAQDQRGTVGTKAQDQRGTVGTKAQDQRGTVGTKAQDQ
KGMVGPKAHGGPPMGPGALPEGYESKMESRADPMGWTKLFDGHLGVAIGWLFPLTLLALL
CGLWWRRRAERTDPVRGGLVMWGVWLVTFGFVFSASAVAHTAYVASLAPAIAAVSALGIV
MFGRAYRRGGRQGWILPLAVAVQLAWAAWLWSHYPNFLPWARWGTLLLGVAALVGLVLAR
VTRTASSALVAAALAVGVGVMLAAPATYAVSVLDPDYSGNSFDANAGPASGTA
selected fasta
>putative mannosyltransferase [putative mannosyltransferase]
GTGGTGTCCGAAACACTCACTCATCCGCCGTCCCAGGATTCCGCGCCCGAGAGCCGGCCT
CACCGCTGGGCGGTATGGCGCTCACCGGCCGGTCAGCCGGCGTGGGCCCGGCCCGCGCTG
CTGGGCATCGCGCTCGTCGCGGCGGTGCTGTATGCCTGGAACCTGCGGCTGGTCGACTAC
GCGCCGCGGTACGCGGACGCCGTCAAGAGCATGTCCGGGAGCTGGCGCGCGTTCCTGTAC
GGCGCCGTCGACCCGGAGGCGACGTACACGCTCGACAAGCTGGCCGGCTCCTTCGTGCCC
CAGGTCGTCTCGGCCAAGATCTTCGGTTATCACGCGTGGTCCCTGGCGTTGCCGCAGGTG
ATCGAGGGCGTGATCGCGGTGCTGGTGATGTACCGGGTCGTACGGCGGTGGGTGGGCGTG
GTGCCCGGCCTGCTCGCCGCCGGCATCTTCACCCTGACCCCGGTCGCCGCGTCCATGTTC
GGGCACAGCATGGAGGACGGCGCACTGGTCATGTGCCTGGTGCTCGCCGTCGACGCGTAT
CAGCGCGCGGTCCTGGAAGGGCGGCTCCGGTCACTGATCGGGGCCGGTGTCTGGGTCGGG
CTGGGCTTCCAGGCCAAGATGGTGCAGGCGTGGATGATTCTGCCCGCCCTGGCGGTCGGC
TACCTGCTGACCGCGCCGATCGAGCTGCGCCGCCGGGTGCGGCATCTCGGGGCCGCCGGG
GCGGTGATGCTGGCGGTGTCGCTGTCGTGGGTCATGCTCTACACCCTCACGCCGGCCAGC
GATCGGCCCTACATCAGTGGCACCACGAACAACAACGCCTTCGCCATGGTGTTCGGATAC
AACGGTCTCGGCCGTGTGGGCATCAACCTGCCCGGCGCCGAGGAGGTCAACGGTCGTAAC
GGCGTGCCGGCGCCCGGTCCGCTGGGCGGCCCGGAGGGCGAGGGCCAGAGGGGAACGGTC
GGCACGAAGGCCCAGGACCAGAGGGGAACGGTCGGCACGAAGGCCCAGGACCAGAGGGGA
ACGGTCGGCACGAAGGCCCAGGACCAGAGGGGAACGGTCGGCACGAAGGCCCAGGACCAG
AAGGGAATGGTCGGGCCGAAGGCCCATGGAGGACCGCCGATGGGACCGGGCGCGCTCCCC
GAGGGATACGAGTCCAAGATGGAGAGCAGGGCCGATCCGATGGGTTGGACCAAGCTGTTC
GACGGTCACCTCGGCGTCGCGATCGGCTGGCTCTTTCCGCTGACTCTGCTCGCCCTGCTG
TGCGGGTTGTGGTGGCGCCGCCGGGCCGAGCGCACCGATCCGGTGCGCGGCGGGCTGGTG
ATGTGGGGGGTGTGGCTGGTGACCTTCGGCTTTGTCTTCAGTGCGAGCGCTGTCGCGCAC
ACCGCCTACGTGGCCTCGCTGGCGCCGGCGATCGCGGCCGTCTCCGCCCTCGGCATCGTG
ATGTTCGGGCGGGCGTATCGGCGCGGCGGCAGGCAGGGCTGGATACTGCCGCTCGCGGTC
GCGGTCCAACTGGCCTGGGCCGCCTGGCTGTGGTCGCACTACCCGAACTTCCTCCCCTGG
GCGAGATGGGGCACGCTCCTGCTCGGCGTGGCCGCCCTTGTCGGGCTGGTCCTGGCGCGC
GTGACCAGGACCGCCTCCTCCGCGCTGGTCGCGGCCGCGCTCGCCGTCGGCGTCGGCGTC
ATGCTGGCCGCGCCCGCCACGTATGCCGTCTCGGTGCTCGATCCCGATTACTCCGGCAAC
TCCTTCGATGCCAACGCGGGACCGGCCTCGGGCACCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [33-55]  Transmembrane (o-i) [137-159]  Transmembrane (i-o) [207-229]  Transmembrane (o-i) [236-258]  Transmembrane (i-o) [403-425]  Transmembrane (o-i) [438-460]  Transmembrane (i-o) [464-486]  Transmembrane (o-i) [493-510]  Transmembrane (i-o) [520-542]  Transmembrane (o-i) [549-571]  Transmembrane (i-o)
Transmembrane 10