close all open/close all

CDS information : Teicp2_00270


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction53,721 / 54,896 / + [in whole cluster]
53,721 / 54,896 / + [in contig]
Location53721..54896 [in whole cluster]
53721..54896 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)OxyA protein
Genetcp18
oxyA
Gene (GenBank)tcp18
EC number
Keyword
  • 3rd cross-linking
  • D-O-E ring
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
Related Reference
ACC
Q6ZZI8
NITE
Teicp_00200
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[26820384] Structure of OxyA tei: completing our picture of the glycopeptide antibiotic producing Cytochrome P450 cascade. (FEBS Lett. , 2016)
ACC
Q8KLL7
NITE
A4793_00090
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [OxyA protein]
MFEEINVVRAAELHRRDRFDPVPQLRSLMAEGPLTTLGTEESPGGRTAWLATGYDEIRQV
LSSDDFSARLLYGGTAAGITWPGFLTQYDPPEHTRLRRMVAPAFAVRRMQKFQPQVERVV
QDSLDAIEALGGPVDFVPRFGWSVATTATCDFLGIPRDDQADLARSLHASRTERSGKRRT
AAGNKFMTYMNKMTARTRRDPGDDMFGVVVREYGDEITDAELTGVAAFVMGAGADQVARF
LAAGAWLMADDPEQFALLREKPDTVPDWLDEVIRYLTTDEKTHPRVATDDVRIGDHLIKA
GDTVTCSLLAANRRNFPRPEDRFDITRVRPEHLAFGHGIHHCLGRSLAELVFRTAIPALA
HRFPTLRLAEPHREIRLGPPPFDVEALLLDW
selected fasta
>cytochrome P450 [OxyA protein]
ATGTTCGAGGAGATCAACGTTGTCCGGGCCGCGGAGCTGCACCGGAGGGACCGATTCGAT
CCGGTGCCACAGCTGCGCTCGCTGATGGCCGAGGGCCCGTTGACCACGCTGGGCACCGAG
GAGTCTCCCGGAGGCCGGACGGCGTGGCTCGCCACCGGGTACGACGAGATCCGGCAGGTT
CTCAGCTCCGACGACTTCAGCGCACGGCTGCTCTACGGGGGAACCGCTGCCGGCATCACC
TGGCCCGGTTTCCTCACCCAGTACGACCCGCCCGAGCACACCCGACTGCGCCGCATGGTG
GCGCCCGCCTTCGCCGTCCGACGGATGCAGAAGTTCCAGCCGCAGGTCGAGCGGGTCGTC
CAGGACAGTTTGGACGCCATCGAGGCGCTCGGCGGACCGGTCGACTTCGTCCCCCGTTTC
GGGTGGTCGGTGGCGACGACGGCGACCTGCGACTTCCTCGGCATTCCGCGCGACGATCAG
GCGGATCTGGCGCGCAGCCTCCATGCCAGCCGAACCGAACGGTCAGGCAAGCGGCGTACC
GCGGCAGGCAACAAGTTCATGACGTACATGAACAAGATGACGGCTCGCACCCGCCGCGAT
CCCGGTGACGACATGTTCGGTGTCGTGGTACGCGAGTACGGCGACGAGATCACCGACGCG
GAGCTGACCGGCGTCGCCGCGTTCGTCATGGGCGCGGGCGCCGACCAGGTGGCCCGTTTC
CTCGCGGCCGGCGCGTGGCTGATGGCCGACGATCCCGAGCAGTTCGCACTGCTGCGGGAG
AAGCCGGACACCGTCCCGGATTGGCTGGACGAGGTGATTCGGTATCTGACCACCGATGAG
AAGACCCATCCGCGCGTCGCGACGGACGACGTGCGCATCGGCGATCACCTCATCAAGGCC
GGCGATACCGTCACGTGCTCCCTGCTGGCTGCCAACCGCCGCAACTTCCCGCGCCCGGAG
GATCGATTCGACATCACCCGGGTCCGGCCGGAGCACCTGGCGTTCGGGCACGGCATCCAT
CACTGCCTGGGCAGGTCTCTGGCCGAGCTGGTGTTCCGGACGGCGATTCCGGCCCTGGCA
CACCGCTTCCCCACGCTGAGGCTGGCCGAGCCGCACCGAGAGATCAGATTGGGGCCGCCG
CCGTTCGACGTGGAAGCCCTGCTGCTCGACTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [14-378]  6.20000000000009e-81 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [269-363]  9e-11 PF00067
PF00067   p450
 [18-391]  4.69998262513189e-74 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  2.80000504261099e-34 PR00359 [135-151]  2.80000504261099e-34 PR00359 [152-167]  2.80000504261099e-34 PR00359 [188-210]  2.80000504261099e-34 PR00359 [267-278]  2.80000504261099e-34 PR00359 [285-312]  2.80000504261099e-34 PR00359 [333-342]  2.80000504261099e-34 PR00359 [342-353]  2.80000504261099e-34 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [335-344]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit