close all open/close all

CDS information : Teicp2_00280


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction54,919 / 56,073 / + [in whole cluster]
54,919 / 56,073 / + [in contig]
Location54919..56073 [in whole cluster]
54919..56073 [in contig]
TypeCDS
Length1,155 bp (384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)Oxy protein
Genetcp19
oxyE
Gene (GenBank)tcp19
EC number
Keyword
  • 2nd cross-linking
  • F-O-G ring
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
Related Reference
ACC
Q6ZZI7
NITE
Teicp_00210
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[20974107] Structural characterization of CYP165D3, a cytochrome P450 involved in phenolic coupling in teicoplanin biosynthesis. (Arch Biochem Biophys. , 2011)
[21445994] Crystal structure of a phenol-coupling P450 monooxygenase involved in teicoplanin biosynthesis. (Proteins. , 2011)
ACC
Q8KLL8
NITE
A4793_00080
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [Oxy protein]
MALPLPHQRLRLDPVPEFEELQKAGPLHEYDTEPGMDGRKQWLVTGHDEVRAILADHERF
SSMRPVDDEADRALLPGILQAYDPPDHTRLRRTVAPAYSARRMERLRPRIEEIVEECLDD
FESVGAPVDFVRHAAWPIPAYIACEFLGVPRDDQAELSRMIRESRESRLPRQRTLSGLGI
VNYTKRLTSGKRRDPGDGMIGVIVREHGAEISDEELAGLAEGNLIMAAEQMAAQLAVAVL
LLVTHPDQMALLREKPELIDSATEEVLRHASIVEAPAPRVALADVRMAGRDIHAGDVLTC
SMLATNRAPGDRFDITREKATHMAFGHGIHHCIGAPLARLQLRVALPAVVGRFPSLRLAV
PEEDLRFKPGRPAPFAVEELPLEW
selected fasta
>cytochrome P450 [Oxy protein]
ATGGCACTTCCTCTGCCGCATCAGCGGCTCCGGCTCGATCCGGTGCCGGAGTTCGAAGAG
CTGCAAAAAGCTGGGCCCCTGCACGAATACGACACCGAGCCGGGCATGGACGGCCGTAAG
CAGTGGCTGGTCACCGGACATGACGAGGTCCGCGCGATCCTCGCCGACCACGAGCGGTTC
AGTTCCATGCGGCCGGTCGACGACGAGGCGGATCGCGCCCTGTTGCCGGGAATCCTGCAG
GCGTACGACCCGCCGGATCACACCCGGCTGCGCAGGACGGTGGCCCCGGCGTATTCCGCC
CGACGGATGGAGCGGCTGCGACCCCGCATCGAGGAGATCGTCGAAGAGTGCTTGGACGAC
TTCGAGAGCGTGGGCGCGCCGGTCGACTTCGTCCGACATGCCGCCTGGCCCATCCCCGCG
TACATCGCCTGCGAATTCCTCGGCGTCCCGCGTGACGACCAGGCGGAGTTGTCGCGGATG
ATCAGGGAGAGCCGGGAGAGTCGGCTTCCCCGGCAGCGGACCCTGTCGGGTCTGGGCATC
GTCAATTACACCAAGCGGTTGACCTCCGGCAAACGCCGTGATCCTGGCGACGGGATGATC
GGCGTGATCGTGCGCGAACACGGCGCTGAGATCAGCGACGAGGAATTGGCGGGGCTCGCC
GAGGGGAACCTGATCATGGCGGCGGAGCAGATGGCCGCGCAGCTGGCGGTCGCGGTGCTC
CTGCTGGTGACCCACCCCGACCAGATGGCGCTGCTGCGCGAGAAACCGGAGCTCATCGAC
AGCGCCACCGAGGAAGTGCTGCGCCACGCGTCCATCGTCGAGGCCCCGGCTCCCCGGGTG
GCGCTCGCTGACGTGCGCATGGCCGGACGCGACATCCATGCCGGCGATGTCCTGACGTGT
TCCATGCTGGCGACCAATCGCGCCCCGGGAGATCGGTTCGACATCACCCGGGAGAAAGCC
ACCCACATGGCATTCGGACACGGCATCCACCACTGTATCGGGGCGCCGCTGGCCCGGCTC
CAGCTGCGGGTGGCGCTGCCGGCGGTGGTCGGCCGGTTCCCGTCTTTGCGGCTGGCGGTC
CCGGAGGAGGACCTGCGGTTCAAACCGGGCAGGCCGGCACCCTTCGCGGTAGAGGAGCTT
CCCCTTGAGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11-384]  1.19999063421924e-77 SSF48264
SSF48264   Cytochrome_P450
 [257-353]  8.40000000000001e-11 PF00067
PF00067   p450
 [9-384]  9.3000000000001e-87 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [82-93]  1.50000306971104e-30 PR00359 [129-145]  1.50000306971104e-30 PR00359 [146-161]  1.50000306971104e-30 PR00359 [182-204]  1.50000306971104e-30 PR00359 [261-272]  1.50000306971104e-30 PR00359 [323-332]  1.50000306971104e-30 PR00359 [332-343]  1.50000306971104e-30 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [325-334]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit