close all open/close all

CDS information : Teicp2_00290


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction56,063 / 57,259 / + [in whole cluster]
56,063 / 57,259 / + [in contig]
Location56063..57259 [in whole cluster]
56063..57259 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)OxyB protein
Genetcp20
oxyB
Gene (GenBank)tcp20
EC number
Keyword
  • 1st cross-linking
  • C-O-D ring
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
Related Reference
ACC
Q6ZZI6
NITE
Teicp_00220
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[25358800] Cytochrome P450 OxyBtei catalyzes the first phenolic coupling step in teicoplanin biosynthesis. (Chembiochem. , 2014)
ACC
Q8KLL9
NITE
A4793_00070
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [OxyB protein]
MSGDGSPPIHTRRQGFDPADELRAAGTLTKISIGSGADAETTWLAAGHAVVRQVLGDHKR
FSTRRRFDRRDEIGGTGVFRPRELVGNLMDYDPPEHTRLRHLLTPGFTQRRMRRLAPRIE
EIVTDRLDAMEQAGPPADLIELFADEVPGAVLCELIGVPRDDQAMFLQLCHRHLDASLSA
RKRAAAGEAFARYLVAMMARERKDPGDGFIGSIVAEHGDTITDEELRGVCVQLMLAGDDN
VSGMIGLGVLALLRHPEQIAALRGDDQSADRAVDELIRYLTVPYAPTPRTAVEDVMVADQ
VIKEGETVLCSLPMANRDRALLPDADRLDVTRTPVPHVAFGHGIHHCLGAALTRLQLRIA
YTALWRRFPALQLADPAQEIMFRTSTPAYGLTSLLVAW
selected fasta
>cytochrome P450 [OxyB protein]
TTGAGTGGTGACGGCTCGCCTCCGATCCACACCCGCCGGCAGGGTTTCGATCCGGCCGAC
GAACTGCGCGCCGCCGGAACGCTGACGAAGATTTCCATCGGCTCCGGAGCGGACGCCGAG
ACCACCTGGCTGGCGGCCGGGCACGCCGTCGTGCGCCAGGTTCTGGGCGATCACAAGCGA
TTCAGCACCCGGCGCCGCTTCGACCGACGTGACGAGATCGGCGGGACGGGCGTCTTCCGC
CCGCGTGAGCTGGTCGGCAACCTGATGGACTACGACCCACCGGAGCACACCCGGCTCCGG
CACCTGCTGACCCCGGGATTCACCCAGCGCCGGATGCGTCGTCTGGCGCCGCGCATCGAA
GAGATCGTGACCGACCGCCTCGACGCCATGGAGCAGGCGGGGCCGCCGGCGGACCTGATC
GAGCTGTTCGCCGACGAGGTGCCCGGAGCCGTGCTGTGCGAGCTGATCGGAGTACCCCGC
GACGATCAGGCCATGTTCCTGCAGCTGTGTCACCGGCATCTCGACGCCTCGCTGAGTGCC
AGGAAACGGGCGGCCGCCGGGGAGGCGTTCGCCCGCTACCTGGTGGCCATGATGGCCAGG
GAACGCAAGGACCCCGGCGACGGGTTCATCGGCTCGATCGTCGCCGAACACGGCGACACG
ATCACGGATGAGGAGCTGAGAGGCGTCTGTGTGCAGCTGATGCTGGCCGGTGACGACAAC
GTCTCCGGCATGATCGGGCTGGGGGTGCTGGCGTTGCTGCGACATCCCGAGCAGATCGCC
GCGTTGCGCGGGGACGATCAGTCGGCGGATCGAGCTGTCGACGAGCTGATCCGGTACCTG
ACGGTCCCATACGCCCCGACACCGCGGACCGCCGTGGAGGACGTCATGGTTGCCGACCAG
GTGATCAAGGAGGGCGAGACGGTTCTCTGCTCTCTCCCGATGGCCAACCGTGACCGCGCC
CTGCTGCCGGATGCCGACCGCCTCGACGTGACCCGTACGCCCGTTCCGCATGTCGCGTTC
GGACACGGTATCCATCACTGTCTGGGCGCCGCTCTGACGCGCCTGCAACTGCGAATCGCC
TATACCGCCCTGTGGCGGCGCTTTCCCGCTTTGCAACTGGCGGACCCCGCCCAGGAAATA
ATGTTCCGGACGAGTACCCCGGCGTATGGATTAACCAGTCTGCTGGTTGCCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [20-398]  2.30000000000004e-90 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [5-398]  1.3000049540733e-85 SSF48264
SSF48264   Cytochrome_P450
 [215-368]  2e-13 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  2.50000909916183e-49 PR00359 [138-154]  2.50000909916183e-49 PR00359 [155-170]  2.50000909916183e-49 PR00359 [192-214]  2.50000909916183e-49 PR00359 [271-282]  2.50000909916183e-49 PR00359 [289-316]  2.50000909916183e-49 PR00359 [317-332]  2.50000909916183e-49 PR00359 [338-347]  2.50000909916183e-49 PR00359 [347-358]  2.50000909916183e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit