close all open/close all

CDS information : Teicp2_00300


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction57,554 / 59,029 / + [in whole cluster]
57,554 / 59,029 / + [in contig]
Location57554..59029 [in whole cluster]
57554..59029 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)tcp21
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZI5
NITE
Teicp_00230
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q7WZ81
NITE
A4092_00160
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
ACC
G4V4R7
NITE
Vanco_00150
PmId
[24756572] Bis-chlorination of a hexapeptide-PCP conjugate by the halogenase involved in vancomycin biosynthesis. (Org Biomol Chem. , 2014)
ACC
R4T052
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative halogenase [halogenase]
MPVEEFDVVVAGGGPAGSTVATLVAMQGHRVLLLEKETFPRYQIGESLLPSTVHGVCRML
GVSDELAAAGFPVKRGGTFRWGARPEPWTFSFAVSPLMNGPTSFAYQVERARFDEILLRN
AQRKGVDVREGCSVTGVIEGDERITGVRYTDPDGGEHEVSARFVVDASGNKSRLYSQVGG
VRNYSEFFRSLALFGYFENGKRLPEPYSGNILSVAFDSGWFWYIPLSDTMTSVGAVVRRE
MAEKIQGDREKALQALIAECPLISDYLADARRITTGRYGELRVRKDYSYHQTSYWRPGMI
LVGDAACFVDPVFSSGVHLATYSALLAARSINSVLAEDLDEKTALSEFEARYRREYGVFY
EFLVSFYQMNVNEESYFWQAKKVTNNKHTEIESFVELIGGVSSGEAALATAGRIAERSAE
FAAAVDQMAASADGNMVPMYKSEVVKQVMQEGGQVQMKAVLGADAEPELPLFPGGLVVSP
DGMKWLPYRPA
selected fasta
>putative halogenase [halogenase]
ATGCCGGTGGAAGAGTTCGACGTGGTGGTGGCCGGTGGCGGGCCGGCCGGTTCGACCGTG
GCCACGCTGGTGGCCATGCAGGGCCATCGGGTGCTGCTGCTGGAGAAGGAGACCTTCCCC
CGGTACCAGATCGGCGAGTCGTTGCTGCCCTCCACCGTCCACGGGGTGTGCCGGATGCTC
GGCGTCTCGGACGAGCTGGCGGCAGCCGGCTTCCCCGTCAAGCGCGGCGGCACCTTCCGC
TGGGGCGCCCGCCCGGAGCCGTGGACGTTCTCCTTCGCCGTCTCGCCCCTGATGAACGGC
CCGACGTCGTTCGCGTACCAGGTCGAACGGGCGCGCTTCGACGAGATCCTGCTGCGTAAC
GCGCAGCGCAAGGGCGTCGACGTGCGCGAGGGATGCTCGGTCACCGGGGTGATCGAAGGC
GACGAGCGGATCACCGGGGTGCGTTACACCGACCCCGACGGCGGCGAGCACGAGGTGTCG
GCGCGGTTCGTGGTCGACGCGTCGGGCAACAAGAGCCGGCTGTACTCCCAGGTCGGCGGC
GTCCGCAACTATTCGGAGTTCTTCCGCAGCCTGGCGCTGTTCGGTTACTTCGAGAACGGC
AAGCGGCTGCCGGAGCCGTACTCGGGCAACATCCTGAGCGTCGCGTTCGACAGCGGCTGG
TTCTGGTACATCCCGCTGAGCGACACGATGACCAGCGTCGGCGCGGTGGTGCGCCGGGAG
ATGGCGGAGAAGATCCAGGGCGACCGGGAGAAGGCGCTCCAGGCCCTGATCGCCGAATGC
CCGCTGATCTCCGACTACCTCGCCGACGCGCGCCGGATCACCACCGGCCGGTACGGAGAA
CTGCGGGTCCGCAAGGACTACTCGTATCACCAGACCAGCTACTGGCGGCCCGGGATGATC
CTGGTCGGGGACGCCGCGTGCTTCGTGGACCCGGTGTTCTCCTCGGGCGTGCACCTGGCG
ACCTACAGCGCGCTGCTGGCGGCGCGGTCGATCAACAGCGTGCTCGCCGAGGACCTGGAC
GAGAAGACCGCGCTGAGTGAGTTCGAGGCCCGCTACCGCCGCGAGTACGGGGTGTTCTAC
GAGTTCCTGGTGTCCTTCTACCAGATGAACGTCAACGAGGAGTCGTACTTCTGGCAGGCC
AAGAAGGTCACCAACAACAAGCACACCGAGATCGAGTCGTTCGTGGAGCTGATCGGCGGG
GTGTCGTCGGGTGAGGCGGCGCTGGCCACGGCCGGCCGGATCGCCGAGCGCAGCGCCGAG
TTCGCCGCGGCCGTGGACCAGATGGCCGCCAGCGCCGACGGCAACATGGTGCCGATGTAC
AAGTCGGAAGTGGTCAAGCAGGTGATGCAGGAGGGCGGCCAGGTGCAGATGAAGGCGGTG
CTCGGCGCGGACGCCGAGCCCGAGCTGCCGCTGTTCCCCGGCGGGCTGGTGGTCTCGCCC
GACGGGATGAAGTGGCTGCCCTACCGTCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  3.6000003870074e-08 PR00420 [160-175]  3.6000003870074e-08 PR00420 [296-311]  3.6000003870074e-08 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [7-94]  1.99999999999999e-25 PF04820 [100-426]  1.60000000000002e-83 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit