close all open/close all

CDS information : Teicp2_00320


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction60,486 / 61,712 / + [in whole cluster]
60,486 / 61,712 / + [in contig]
Location60486..61712 [in whole cluster]
60486..61712 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
UDP-N-acetyl-glucosamine transferase
Product (GenBank)GtfB protein
Genetcp23
tgtfB
Gene (GenBank)tcp23
EC number
Keyword
  • Hpg4
  • N-acyl-glucosamine moiety
Note
Note (GenBank)
Reference
ACC
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[17661468] Kinetic analysis of teicoplanin glycosyltransferases and acyltransferase reveal ordered tailoring of aglycone scaffold to reconstitute mature teicoplanin. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q6ZZI3
NITE
Teicp_00250
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[17009278] Identification of a deacetylase involved in the maturation of teicoplanin. (Chembiochem. , 2006)

close this sectionSequence

selected fasta
>glycosyltransferase [GtfB protein]
MRVLLSTTGGRGDVEPLVALAVRFRELGVDARVCAPPDCADRLAGVGVPLVEVGESVRAM
MHGGKRPSPEDAPRLDAEAIATQFDKVPAAAEGCAAVVTTGLLSAAVAVRSVAEKLRIPY
VYAAYCPIYLPSPYYPPPPALGGPPVPELTDNRAQWNRHSQGAYRRFGAALNSHRAAIGL
PPVENIYDYAFSDHPWLAADPVLAPLQPTDLDVVQTGAWILPDQRPLSAELEGFLRAGSP
PVYVGFGSGPAPAEAARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLF
GRVAAVVHAGSAGTTTAVTRAGAPQVVVPQMTDQPYYAGRVADLGVGVAHDGPTPTVESL
SAALATALTPGIRARAAAVAGTIRTDGTTVAAKLLLEAISRQRSSVSA
selected fasta
>glycosyltransferase [GtfB protein]
ATGCGTGTGTTGTTGTCGACGACCGGAGGGCGCGGCGACGTCGAACCGCTGGTCGCGCTG
GCGGTGCGGTTCCGCGAACTGGGTGTGGACGCGCGGGTCTGCGCACCGCCGGACTGCGCG
GACCGGCTGGCCGGCGTCGGTGTGCCACTGGTGGAGGTCGGCGAGTCGGTGCGCGCGATG
ATGCACGGAGGGAAGCGGCCGTCGCCCGAGGACGCGCCCCGGCTCGACGCCGAGGCCATC
GCTACGCAGTTCGACAAGGTCCCGGCGGCCGCCGAGGGCTGCGCCGCGGTGGTGACGACC
GGCCTGTTGTCCGCCGCGGTCGCGGTGCGGTCCGTGGCCGAGAAGCTGCGCATCCCCTAC
GTCTACGCCGCCTACTGCCCGATCTATCTGCCGTCGCCGTACTACCCGCCGCCGCCGGCC
CTGGGCGGCCCGCCCGTACCGGAACTGACCGACAACCGGGCGCAGTGGAACAGGCACAGC
CAGGGTGCCTACCGGCGGTTCGGCGCCGCGCTCAACAGCCACCGGGCGGCGATCGGCCTG
CCGCCGGTGGAGAACATCTACGACTACGCCTTCAGCGATCACCCGTGGCTGGCGGCCGAT
CCGGTCCTGGCCCCGCTGCAGCCGACCGATCTCGACGTGGTGCAGACCGGCGCGTGGATC
CTGCCCGACCAGCGGCCGTTGTCGGCGGAGTTGGAGGGGTTCTTGAGGGCTGGCTCGCCT
CCGGTGTACGTGGGTTTCGGCAGTGGGCCGGCGCCTGCCGAGGCCGCGCGGGTGGCCATC
GAGGCGGTTCGGGCTCAGGGCCGCCGGGTGGTGCTGTCCAGTGGTTGGGCCGGGTTGGGC
CGGATCGACGAGGGGGATGACTGTCTGGTGGTGGGCGAGGTGAACCATCAGGTGCTGTTC
GGCCGGGTGGCCGCCGTCGTCCACGCCGGCAGTGCGGGCACGACGACCGCGGTGACCCGG
GCGGGCGCTCCGCAGGTCGTGGTGCCCCAGATGACGGATCAGCCCTACTATGCCGGTCGG
GTGGCTGACCTGGGTGTCGGCGTGGCGCATGACGGTCCGACCCCGACCGTCGAGTCCCTG
TCCGCGGCGCTGGCCACGGCATTGACCCCGGGGATCCGGGCGCGAGCGGCGGCGGTGGCC
GGCACGATCCGCACCGACGGGACGACGGTGGCCGCGAAACTGCTCCTCGAGGCGATCAGC
CGGCAGAGATCGTCGGTCTCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-132]  4.70000000000001e-22 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit