close all open/close all

CDS information : Teicp2_00330


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction61,858 / 62,829 / + [in whole cluster]
61,858 / 62,829 / + [in contig]
Location61858..62829 [in whole cluster]
61858..62829 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductN-acyltransferase
Product (GenBank)hypothetical protein
Genetcp24
tatf
Gene (GenBank)tcp24
EC number2.3.1.-
Keyword
  • N-acyl-glucosamine moiety
Note
Note (GenBank)
  • similar to hypothetical protein from A40926 gene cluster
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15664522] Tailoring of glycopeptide scaffolds by the acyltransferases from the teicoplanin and A-40,926 biosynthetic operons. (Chem Biol. , 2005)
[17661468] Kinetic analysis of teicoplanin glycosyltransferases and acyltransferase reveal ordered tailoring of aglycone scaffold to reconstitute mature teicoplanin. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q6ZZI2
NITE
Teicp_00260
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[25095906] Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus. (J Am Chem Soc. , 2014)

close this sectionSequence

selected fasta
>N-acyltransferase [hypothetical protein]
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVA
AAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVP
AVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQ
FSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLD
PQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLE
RAVIAHLKAGRHWHMRTGFVKLP
selected fasta
>N-acyltransferase [hypothetical protein]
ATGGATCCCGAGACCGTACGCATCGCGCTGGGGTTGGAGGAACGGACCGCGGCGTGGCTC
ACCGAGCTCGATGAGCTCGGTCCGCCCGCCGAGCCGGTACGGCTGCCGCGCGGCGAGGAG
GCACGTGATCTGCTACGGCGTCTGGAGGTGCCGGAGCTCGACGCCGAGGAGATCGTGGCG
GCCGCTCCCGATCCGGATCGTGACCCGGCCCTGTGGTGGCTGCTCGAACGCACCCACCAC
GCGATCGTCCGGCACATGGGCGACCACCGGGCGAAGCCACGCGGCGGTCCGCCCCTGCCG
TACGAGGGCGGCGCCGCCGCACGCTACTTCCACGTGTACGTCTTCCTCGCGACGGTGCCG
GCGGTGCGCCGCTTCCACGCGGAACGGGGTATCCCCGACGAGGTCGGCTGGGAGACCCTG
ACGCAGTTGGGGGAGCTGGTGGCCATTCATCGCCGCAAGTACGGCCAGGGCGGCATGAAC
ATGCAGTGGTGGACCACCTACCACCTGCGCGGCATCCTCTACCGGCTCGGCCGCCTGCAA
TTCAGTCTGGCCACCGGAAAGGACGGCACGCCGCACCTCGGCCTGCACGTTCCCGAGTGG
GGCGGACCGCTGTTGCCCAAGGCCTATGACGAATCGTTGCATCGTGCCCGCCCGTTCTTC
GACCGGCATTTTCCCGAGCACGGCGCCCGGGTGGCCTGGGGAAGCTCGTGGATGCTCGAT
CCGCAACTGGAGGAGTATCTCACCGAGGACTCCAACATCATTCAGCTTGCGCGGTTCTGG
ACGCTCACCGACTCCGCGCCGGAGCCCGGTAACGCGGACGGGGACTCCTCGATCCTGGAG
TTCGTGTTCCGCTACAACGGCCAGCCGCTGGATGAACTTCCGCAGCGTTCCTCGCTGGAG
CGCGCGGTGATCGCCCATCTGAAGGCCGGACGTCACTGGCACATGCGGACCGGCTTCGTG
AAGCTGCCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit