close all open/close all

CDS information : Teicp2_00350


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction64,782 / 66,578 / + [in whole cluster]
64,782 / 66,578 / + [in contig]
Location64782..66578 [in whole cluster]
64782..66578 [in contig]
TypeCDS
Length1,797 bp (598 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative carboxylic acid--ACP ligase
putative acyl-ACP synthetase
Product (GenBank)acyl-CoA ligase
Gene
Gene (GenBank)tcp26
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZI0
NITE
Teicp_00280
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q50E76
PmId
[18959760] Role of DptE and DptF in the lipidation reaction of daptomycin. (FEBS J. , 2008)
ACC
D2IKP9
PmId
[20081823] In vitro reconstruction of tetronate RK-682 biosynthesis. (Nat Chem Biol. , 2010)

close this sectionSequence

selected fasta
>putative carboxylic acid--ACP ligase [acyl-CoA ligase]
MGYDMATAPDLVTLIRQHVAGRPDADAVGFLTDPDDIRGGVVSWTYGQLDREARGYAAWL
QQRLPAGSRVLLLYPNGLDFVAAFFGCLYAGMIAVPAPLPGRYRHHQHRVATISADARVS
AVLTTAAHLGEVRDWARACGLDHLLIAVGDEPEFGDPAGWTPASPERATIALLQYTSGST
GDPKGVVVTHDNILYNLDACVRGLRWPDDWRVGGWLPLYHDLAMQGLLNMAVVRGGYALL
MEPVSFVRDPVRWLRTIAEHDIQVTFAPTFAYQLCLDRVTDEQLAALDLSGWKIAGNAAE
PVNPAILAAFAEKFAPAGFRPESFAPIYGMAEATGYISGEVGRAPLVRTVGLDALAHGRL
ADPAPDEPVREIVSCGTPNEACDIRVVDPETSRVRPDGWLGEIWIRGRSVSPGYWSDAGP
AFAAVTAEGEDGFLRTGDLGVLQDGELYVHGRLKETFTVHGRHLYPHDVEQELRARHPEL
GKCGAVFPGRAPGAGGARGVVVTHEVTNAARDRLPELAAGLRHTVGRAFGVEVSAVLLLR
PGAVLRTTSGKIRRSAMRELFHEGKLTALYQHPPAPREPLPYVGDPSPATRVTSLSRP
selected fasta
>putative carboxylic acid--ACP ligase [acyl-CoA ligase]
ATGGGCTACGACATGGCCACCGCACCCGATCTCGTAACTCTGATCCGTCAGCATGTCGCC
GGGCGGCCGGACGCCGACGCCGTCGGCTTTCTCACCGACCCGGACGACATCCGCGGCGGG
GTCGTGTCGTGGACCTACGGGCAGCTCGACCGGGAGGCTCGCGGGTACGCGGCCTGGTTG
CAGCAGCGCCTGCCCGCCGGCTCGCGGGTGCTGCTGCTGTATCCCAACGGGCTCGACTTC
GTCGCGGCGTTCTTCGGCTGCCTGTATGCCGGCATGATCGCGGTACCGGCGCCGCTGCCC
GGCCGTTATCGCCATCACCAACATCGGGTCGCGACCATCAGCGCCGATGCCCGGGTCAGC
GCGGTCCTGACCACGGCGGCGCATCTGGGGGAGGTCCGCGACTGGGCTCGGGCGTGCGGA
CTGGACCACCTGCTGATCGCGGTCGGCGACGAACCGGAGTTCGGCGATCCGGCGGGCTGG
ACGCCGGCGTCACCGGAACGTGCGACCATCGCGCTGTTGCAGTACACGTCCGGGTCGACC
GGCGACCCGAAGGGAGTCGTGGTCACCCACGACAACATCCTGTACAACTTGGATGCCTGC
GTCCGGGGCCTGCGCTGGCCGGACGACTGGCGGGTGGGCGGGTGGCTTCCGCTCTACCAC
GACCTGGCGATGCAGGGGCTGCTCAACATGGCCGTCGTGCGCGGCGGCTATGCCTTGCTG
ATGGAGCCGGTCTCGTTCGTGCGCGATCCGGTGCGCTGGCTGCGGACGATAGCCGAACAC
GACATCCAGGTGACGTTCGCGCCCACCTTCGCGTACCAACTGTGCCTCGACCGGGTCACC
GACGAGCAGCTGGCCGCTCTCGATCTGTCCGGCTGGAAGATCGCCGGGAACGCCGCGGAG
CCGGTGAACCCGGCGATCCTGGCCGCGTTCGCTGAGAAGTTCGCGCCGGCCGGGTTCCGC
CCCGAGTCCTTCGCGCCCATCTACGGGATGGCGGAGGCCACCGGCTACATCAGCGGGGAG
GTGGGGCGTGCGCCGCTGGTGCGTACCGTCGGCCTCGACGCGCTCGCCCATGGCCGGCTC
GCCGACCCGGCGCCGGACGAGCCGGTACGCGAAATCGTCAGCTGCGGCACTCCGAACGAG
GCGTGCGACATCCGTGTGGTGGACCCGGAGACGTCGCGCGTGCGGCCCGACGGGTGGTTG
GGCGAGATCTGGATACGCGGGCGCAGCGTGTCCCCGGGCTACTGGAGCGATGCCGGGCCG
GCCTTCGCCGCGGTGACGGCCGAGGGGGAGGACGGCTTCCTGCGTACCGGCGACCTCGGC
GTGCTGCAGGACGGTGAGCTGTACGTGCACGGCCGGCTCAAGGAGACGTTCACCGTGCAC
GGTCGCCACCTCTACCCGCACGACGTCGAGCAGGAACTGCGCGCACGGCACCCGGAACTC
GGCAAGTGCGGCGCGGTCTTCCCGGGACGGGCTCCCGGCGCCGGCGGCGCGCGGGGCGTG
GTCGTGACCCATGAGGTGACCAACGCGGCGCGGGATCGGCTGCCGGAGCTGGCCGCCGGG
TTACGGCATACCGTGGGGCGGGCATTCGGCGTCGAGGTCTCCGCGGTGCTGCTGCTACGT
CCGGGTGCCGTGCTGCGTACCACCAGCGGGAAGATCCGCCGCTCGGCCATGCGTGAGCTG
TTCCACGAGGGAAAGCTGACCGCTCTCTACCAGCATCCTCCGGCGCCGCGGGAGCCGCTG
CCCTACGTGGGGGATCCGTCGCCGGCGACCAGGGTGACCAGCCTTTCGCGTCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [45-481]  2.09999999999996e-82 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [173-184]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM
 [71-93]  Transmembrane (i-o)
Transmembrane 1