close all open/close all

CDS information : Teicp2_00410


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction74,841 / 76,142 / + [in whole cluster]
74,841 / 76,142 / + [in contig]
Location74841..76142 [in whole cluster]
74841..76142 [in contig]
TypeCDS
Length1,302 bp (433 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase
Product (GenBank)DpgC protein
Genetcp32
dpgC
Gene (GenBank)tcp32
EC number
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZH4
NITE
Teicp_00340
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q8KLK7
NITE
A4793_00200
PmId
[17507985] Structural basis for cofactor-independent dioxygenation in vancomycin biosynthesis. (Nature. , 2007)
[18703850] Not so clear on oxygen. Comment on Structural basis for cofactor-independent dioxygenation in vancomycin biosynthesis by Widboom et al. (2007), Nature (London), 447, 342-345. (Acta Crystallogr D Biol Crystallogr. , 2008)
[18004875] Substrate recognition and catalysis by the cofactor-independent dioxygenase DpgC. (Biochemistry. , 2007)
ACC
O52812
NITE
Chlor_00300
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[15380180] DpgC is a metal- and cofactor-free 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase in the vancomycin biosynthetic pathway. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [DpgC protein]
MTVTAVPRDLGADRKRLAEAAARADRLIAALPPPSRRTAQQRAEAAAAHDAARRLRAGFL
NAYADRVYDELTEDRTRFLRIDELAEAAAYAFPGLAPTAQQLARERSRPQADQEGLEIDQ
GILLRAVLRSPRSGRHLMEAMLRPTPRALRLLAEFRRTGVLQTEAVRLERHEQVAELTLC
RDDCLNAEDEQQVDDMETAVDLALLDPAVRIGLVRGGVMSHPRYRGRRVFSAGINLKAIS
AGRISLTGFLLRRELGYLHKLVRGLSDDDPQRWTPPVEKPWVAAVDTFAIGGGCQLLLVF
DHVLAASDAYLSLPAAREGIVPGAGNLRLGRIAGARLSRQVILAGRRIAAAEPDARLLVD
EVVPPEEMDEAVRRCLARLSGDAVVANRRMINVAEEPLDALRVYLAEFALEQALRIHAGD
VIDKVGRFAERSA
selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [DpgC protein]
ATGACGGTGACCGCCGTGCCGCGCGACCTCGGCGCCGACCGCAAGCGCCTGGCCGAGGCC
GCGGCCCGCGCCGACCGGCTGATCGCGGCGCTGCCCCCGCCCAGCCGGCGGACGGCGCAG
CAGCGGGCCGAGGCGGCGGCCGCCCACGACGCGGCGCGCCGCCTGCGGGCCGGGTTCCTG
AACGCGTACGCCGACCGCGTCTACGACGAGCTCACCGAGGACCGCACCCGGTTCCTGCGC
ATCGACGAGCTGGCCGAGGCCGCGGCGTACGCGTTCCCGGGCCTGGCGCCCACCGCGCAG
CAGCTGGCCCGGGAACGCTCCCGCCCCCAGGCCGACCAGGAGGGGCTGGAGATCGACCAG
GGCATCCTGCTGCGGGCGGTGCTGCGGTCGCCGCGCTCGGGCCGGCACCTGATGGAGGCG
ATGCTGCGCCCCACCCCGCGGGCGTTGCGGCTGCTCGCGGAGTTCCGGCGCACCGGCGTG
CTGCAGACCGAGGCGGTCCGGCTGGAGCGGCACGAGCAGGTGGCCGAGCTCACCCTGTGC
CGCGACGACTGTCTCAACGCCGAGGACGAGCAGCAGGTCGACGACATGGAGACCGCCGTG
GACCTGGCCCTGCTCGACCCGGCCGTACGGATCGGCCTGGTCCGCGGCGGCGTGATGAGC
CACCCGCGGTACCGGGGCCGCCGGGTGTTCAGCGCCGGGATCAACCTCAAGGCGATCAGC
GCCGGCCGGATCTCGCTGACCGGCTTCCTGCTCCGCCGCGAACTGGGCTACCTGCACAAA
CTGGTGCGCGGGTTGTCCGACGACGACCCGCAGCGGTGGACGCCGCCGGTGGAGAAGCCG
TGGGTGGCCGCTGTCGACACGTTCGCCATCGGTGGCGGCTGCCAGCTGCTGCTGGTCTTC
GACCACGTGCTGGCCGCCTCGGACGCGTACCTGAGCCTGCCGGCGGCCCGGGAGGGGATC
GTCCCGGGCGCCGGCAACCTGCGTCTGGGCCGGATCGCCGGGGCCCGGCTGTCGCGCCAG
GTCATCCTGGCCGGCCGCCGGATCGCCGCCGCCGAGCCGGATGCGCGCCTGCTGGTGGAC
GAGGTGGTGCCGCCGGAGGAGATGGACGAGGCGGTGCGGCGCTGCCTGGCCCGGCTGTCC
GGCGACGCCGTGGTGGCCAACCGGCGGATGATCAACGTGGCCGAGGAGCCGCTCGACGCG
CTGCGCGTGTACCTGGCCGAGTTCGCGCTCGAACAGGCGCTGCGCATCCACGCCGGCGAC
GTGATCGACAAGGTGGGCCGGTTCGCGGAGCGGTCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [169-410]  1.2e-22 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit