close all open/close all

CDS information : Teicp2_00430


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction77,016 / 78,377 / + [in whole cluster]
77,016 / 78,377 / + [in contig]
Location77016..78377 [in whole cluster]
77016..78377 [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)membrane ion antiporter
Gene
Gene (GenBank)tcp34
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZH2
NITE
Teicp_00360
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q939X8
NITE
Balhi_00270
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [membrane ion antiporter]
MSFEAPPSSLGGHALLAFLIAVATLLLVAHLLARLAERVRMPAVVGELATGVILGPSLLG
HLLPGLTDWVFPPGTDQMHLLDAVGQIGILLLVGLTGTHLDVAMVRRRKATAARISLGGL
LLPLALGVGVGYQLAGWLSGAVVGDRLVFAGFMGVAMCVTAIPVIAKTLSDMRLLHRDVG
QMTLAAGTIDDAVGWFLLSVVSMAATAGLTTGHVVQAVAYLLGFVVLAVLLGRPLVRRVM
RLADRGEGSGSSIVTAVVVVLTGAAITQALGMEPVFGAFVAGILVGLPAAANQAKLAALR
TVVLSVLAPLFLATAGFRMDLTALADPQVAIAAVLVLAIAIVGKFAGAYAGARLSRLSRW
EGLAIGAGMNSRGVVEVVVALTGLRLGVLNTATYTIVVLVAIVTSVMAPPLLRYACARIA
QNEDERLRKLHHDTWNGVPAGAGQSPSPAGEQA
selected fasta
>putative transporter [membrane ion antiporter]
ATGTCCTTCGAAGCGCCGCCGTCGTCACTGGGCGGCCATGCCCTGCTCGCTTTCCTGATC
GCGGTGGCGACGCTGCTGCTGGTCGCCCACCTGCTGGCCCGCCTGGCGGAACGGGTGCGG
ATGCCGGCCGTCGTGGGTGAGCTGGCCACCGGCGTCATCCTGGGCCCGTCCCTGCTGGGC
CACCTGCTGCCCGGACTGACCGACTGGGTCTTCCCGCCCGGCACCGACCAGATGCACCTG
CTCGACGCGGTAGGTCAGATCGGCATCCTGCTCCTGGTCGGACTCACCGGCACCCACCTG
GACGTCGCCATGGTGCGGCGGCGCAAGGCCACCGCCGCGCGGATCAGCCTGGGCGGCCTG
CTGCTGCCGCTGGCTCTCGGGGTCGGCGTCGGCTACCAGCTGGCCGGCTGGCTCAGCGGC
GCCGTGGTCGGTGACCGGCTGGTCTTCGCCGGATTCATGGGCGTCGCGATGTGCGTGACA
GCCATCCCGGTGATCGCCAAAACCCTCTCCGACATGCGGCTGCTGCACCGCGACGTGGGC
CAGATGACGCTGGCGGCGGGCACCATCGACGACGCGGTCGGCTGGTTCCTGCTGTCCGTG
GTGTCGATGGCCGCGACCGCCGGGCTCACCACCGGACACGTCGTCCAGGCGGTCGCCTAC
CTGCTCGGCTTCGTCGTCCTCGCGGTTCTGCTCGGCCGGCCGCTGGTCCGCCGCGTCATG
CGGCTGGCCGACCGCGGCGAGGGATCCGGCTCCAGCATCGTCACCGCGGTCGTCGTCGTC
CTGACCGGCGCGGCGATCACCCAGGCGCTGGGCATGGAGCCGGTCTTCGGCGCCTTCGTG
GCGGGCATCCTGGTCGGGCTGCCCGCGGCGGCGAACCAGGCGAAGCTGGCGGCGCTGCGC
ACGGTCGTGCTCAGCGTGCTGGCGCCGCTCTTCCTCGCCACGGCCGGCTTCCGGATGGAC
CTGACCGCGCTGGCCGACCCGCAGGTCGCGATCGCCGCGGTGCTCGTGCTGGCCATCGCC
ATCGTCGGCAAGTTCGCCGGGGCGTACGCCGGGGCCCGCCTCAGCCGGCTGTCCCGCTGG
GAGGGCCTGGCGATCGGCGCCGGGATGAACTCGCGCGGCGTGGTCGAGGTGGTGGTGGCG
CTCACCGGCCTGCGACTGGGCGTGCTGAACACCGCCACCTACACGATCGTCGTCCTGGTC
GCCATCGTCACCTCGGTGATGGCCCCGCCGCTGCTGCGCTACGCCTGTGCCCGCATCGCC
CAGAACGAGGACGAGCGGCTGCGCAAGCTGCACCACGACACCTGGAACGGCGTCCCGGCC
GGCGCCGGCCAGTCCCCCTCACCCGCAGGAGAGCAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [24-412]  1.29999999999998e-52 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [10-32]  Transmembrane (o-i) [44-66]  Transmembrane (i-o) [81-103]  Transmembrane (o-i) [115-137]  Transmembrane (i-o) [147-169]  Transmembrane (o-i) [182-204]  Transmembrane (i-o) [214-236]  Transmembrane (o-i) [248-270]  Transmembrane (i-o) [274-291]  Transmembrane (o-i) [296-318]  Transmembrane (i-o) [328-350]  Transmembrane (o-i) [386-408]  Transmembrane (i-o)
Transmembrane 12