close all open/close all

CDS information : Teicp2_00440


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction78,374 / 78,970 / + [in whole cluster]
78,374 / 78,970 / + [in contig]
Location78374..78970 [in whole cluster]
78374..78970 [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative GTP cyclohydrolase 1
putative GTP cyclohydrolase I
Product (GenBank)putative GTP cyclohydrolase
Genetcp35
folE
Gene (GenBank)tcp35
EC number3.5.4.16
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZH1
NITE
Teicp_00370
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q8GLS8
PmId
[15135390] Cloning, expression, purification, and characterization of Nocardia sp. GTP cyclohydrolase I. (Protein Expr Purif. , 2004)
ACC
P0A6T5
PmId
[1459137] Allosteric characteristics of GTP cyclohydrolase I from Escherichia coli. (Eur J Biochem. , 1992)
[12297008] Biochemical characterization of oligomerization of Escherichia coli GTP cyclohydrolase I. (J Biochem Mol Biol. , 2002)
Family/Domain
FD
IPR001474

close this sectionSequence

selected fasta
>putative GTP cyclohydrolase 1 [putative GTP cyclohydrolase]
MTVTAKHVGNTRPAPDLATATAAAATFLDALGVDLSPESLQETPARMARAYADLLTAREF
KLTTFDNDEGYDELVMARNIPIRSVCEHHLLPFIGVAHVGYLPAARILGLSKLARVVEMF
AHGTQVQERLTKQIADWLIKELEPNGVGVVIEAEHLCMTLRGVQAVGANTITSSMLGVLR
DDARSRGEFLAAAGLGGR
selected fasta
>putative GTP cyclohydrolase 1 [putative GTP cyclohydrolase]
ATGACCGTCACGGCGAAGCACGTCGGGAACACCCGGCCGGCGCCCGACCTGGCGACCGCG
ACCGCGGCCGCGGCGACCTTCCTCGACGCGCTCGGCGTCGACCTGAGCCCGGAGAGCCTG
CAGGAGACCCCGGCCCGGATGGCCCGGGCGTACGCCGACCTGCTCACCGCCCGCGAGTTC
AAGCTCACCACGTTCGACAACGACGAGGGCTACGACGAGCTGGTGATGGCCCGCAACATC
CCGATCCGCTCGGTGTGCGAGCACCACCTGCTGCCCTTCATCGGCGTCGCGCACGTCGGC
TACCTGCCCGCCGCCCGCATCCTCGGACTGTCCAAGCTGGCCCGGGTCGTCGAGATGTTC
GCGCACGGCACCCAGGTGCAGGAACGGCTGACCAAGCAGATCGCCGACTGGCTGATCAAG
GAGCTGGAGCCGAACGGGGTGGGCGTGGTGATCGAGGCCGAGCACCTGTGCATGACGTTG
CGCGGGGTGCAGGCGGTCGGCGCGAACACCATCACCTCGTCCATGCTCGGCGTGCTGCGC
GACGACGCGCGGTCGCGCGGCGAGTTCCTGGCCGCCGCCGGGCTGGGCGGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001474 GTP cyclohydrolase I (Family)
 [24-192]  4.70000000000003e-58 TIGR00063
TIGR00063   FolE
IPR018234 GTP cyclohydrolase I, conserved site (Conserved_site)
 [73-89]  PS00859
PS00859   GTP_CYCLOHYDROL_1_1
IPR020602 GTP cyclohydrolase I/Nitrile oxidoreductase (Domain)
 [92-177]  4.70000000000003e-34 PF01227
PF01227   GTP_cyclohydroI
SignalP No significant hit
TMHMM No significant hit