close all open/close all

CDS information : Teicp2_00460


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction80,291 / 81,346 / + [in whole cluster]
80,291 / 81,346 / + [in contig]
Location80291..81346 [in whole cluster]
80291..81346 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)HmaS protein
Genetcp37
hmaS
Gene (GenBank)tcp37
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZG5
NITE
Teicp_00430
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [HmaS protein]
MTGHFQDLTVDHVRIYCADLDPLIAQFGSYGLDVRAEGVGPGAEHSVVLGHGDIRLVLTR
PGTGDHPGGMYTAQHGYGVSDIALGTADAAGAFHEAVRRGARPIAAPERTAGVVTASVAG
FGDVIHTFVQREPGGPWSLPGLNPVHRPGTPGIGLRLVDHFAVCVEAGRLTEVVEHYERV
FGFSAIFTERIVVGEQAMDSQVVQSAGGAVTLTVIAPDTTRRPGQIDTFLKDHGGPGVQH
IAFETDDVTRSVGAMSDAGIEFLTTPAAYYERLRDRLQLTRHSVTELSRLNVLADEDHDG
QLYQIFTKSTHPRGTLFFEIIERVGARTFGSGNIKALYEAVELDQAAADGR
selected fasta
>putative 4-hydroxymandelate synthase [HmaS protein]
ATGACCGGCCACTTCCAGGACCTGACCGTCGACCACGTACGGATCTACTGCGCGGACCTC
GACCCGTTGATCGCCCAATTCGGCAGCTACGGCCTCGACGTGCGGGCCGAGGGCGTCGGG
CCGGGCGCGGAGCACTCGGTCGTTCTCGGGCACGGCGACATCCGGCTGGTGCTGACCCGG
CCCGGCACCGGCGACCACCCCGGCGGGATGTACACCGCGCAGCACGGCTACGGCGTGTCC
GACATCGCGCTCGGTACGGCCGACGCGGCCGGCGCCTTCCACGAGGCGGTCCGGCGCGGG
GCACGGCCGATCGCCGCCCCCGAGCGGACCGCCGGCGTGGTCACCGCCTCGGTCGCCGGC
TTCGGCGACGTCATCCACACCTTCGTCCAGCGCGAGCCGGGAGGACCGTGGTCGCTGCCG
GGGCTGAACCCGGTGCACCGGCCCGGCACGCCCGGCATCGGCCTGCGGCTGGTCGACCAC
TTCGCGGTGTGCGTCGAGGCCGGCCGGCTCACCGAGGTCGTCGAGCACTACGAGCGGGTG
TTCGGCTTCTCGGCCATCTTCACCGAGCGGATCGTGGTCGGCGAGCAGGCGATGGACTCC
CAGGTCGTGCAGAGCGCCGGCGGGGCCGTGACGCTCACCGTGATCGCGCCGGACACCACC
CGCCGGCCGGGGCAGATCGACACCTTCCTCAAGGACCACGGCGGCCCGGGGGTCCAGCAC
ATCGCGTTCGAGACCGACGACGTGACCCGCTCGGTCGGCGCCATGAGCGACGCCGGCATC
GAGTTCCTCACCACACCGGCCGCCTACTACGAGAGGCTGCGGGACCGGCTGCAGCTCACC
CGGCACTCGGTCACCGAGCTGAGCCGGCTCAACGTGCTCGCCGACGAGGACCACGACGGC
CAGCTCTACCAGATCTTCACCAAGTCCACGCACCCGCGGGGAACGCTGTTCTTCGAGATC
ATCGAGCGGGTCGGGGCCCGGACCTTCGGCTCCGGCAACATCAAGGCCCTGTACGAGGCC
GTGGAGCTGGACCAGGCCGCGGCAGACGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [10-347]  6.29999999999998e-100 TIGR01263
TIGR01263   4HPPD
 [1-351]  PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit