close all open/close all

CDS information : Teicp2_00470


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction81,343 / 82,437 / + [in whole cluster]
81,343 / 82,437 / + [in contig]
Location81343..82437 [in whole cluster]
81343..82437 [in contig]
TypeCDS
Length1,095 bp (364 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate oxidase
Product (GenBank)Hmo protein
Genetcp38
hmo
Gene (GenBank)tcp38
EC number1.1.3.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZG4
NITE
Teicp_00440
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
O52792
NITE
Chlor_00230
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12240298] Characterisation of a hydroxymandelate oxidase involved in the biosynthesis of two unusual amino acids occurring in the vancomycin group of antibiotics. (Chem Commun (Camb). , 2001)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate oxidase [Hmo protein]
MTTAVLRLDTVDDFRLRAEATLTAAVRDFVAGGSDSETTLAANRAALDRVTIVPRVLTGG
PDPEPGATLAGARSALPLAVAPMAYQRLLHPEGELATARAAAAAGVPFVVSTLSSVPVGE
LAAAGGEQWFQLYWLNDDRDTMNLVHRAEDAGCRVLMVTVDVPVMGRRLRDIRNEFVLPA
EVRAANVASGAMSAAHDRADAGSALIAHTNRAFHPALTWAHLEALRSRTTLPIVVKGILD
PADARRAAEIGATGVVISNHGGRQLDGAPASVTMLPAAVAAVPDTCQVFVDSGIRSGTDI
LRALALGAHGVLIGRPMLWGLAAGGETGAAGVLAVLDAELRAAMRLAGCADVAAARRLTA
TTGC
selected fasta
>putative 4-hydroxymandelate oxidase [Hmo protein]
ATGACCACCGCTGTGCTGCGGCTGGACACGGTCGACGATTTCCGGCTGCGCGCCGAGGCG
ACGCTGACCGCCGCGGTCCGTGACTTCGTGGCCGGCGGCAGCGACTCGGAGACCACCCTG
GCGGCCAACCGGGCGGCGCTGGACCGGGTGACGATCGTCCCGCGGGTGCTGACCGGCGGG
CCCGACCCGGAACCGGGCGCCACGCTGGCCGGGGCCCGCAGCGCGCTGCCGCTGGCCGTG
GCGCCGATGGCGTACCAGCGGCTGTTGCACCCGGAGGGGGAGCTGGCGACGGCGCGCGCC
GCGGCGGCCGCCGGTGTCCCCTTCGTGGTCAGCACGCTCAGCAGCGTCCCGGTCGGCGAG
CTGGCCGCGGCCGGCGGCGAACAGTGGTTCCAGTTGTACTGGCTCAACGACGACCGCGAC
ACGATGAACCTGGTCCACCGGGCCGAGGACGCCGGCTGCCGGGTGCTGATGGTGACCGTG
GACGTTCCGGTGATGGGCCGGCGCCTGCGGGACATCCGCAACGAGTTCGTGCTGCCCGCC
GAGGTGCGGGCGGCGAACGTCGCGTCCGGGGCGATGAGCGCGGCGCACGATCGCGCCGAC
GCCGGCTCCGCCTTGATCGCGCACACCAACCGCGCGTTCCATCCGGCGCTCACCTGGGCG
CACCTGGAGGCGCTGCGCTCGCGGACCACCCTGCCGATCGTGGTGAAGGGCATCCTGGAC
CCCGCGGACGCCCGCCGCGCGGCCGAGATCGGCGCGACCGGCGTGGTGATCTCCAACCAC
GGCGGCCGCCAGCTCGACGGCGCGCCGGCCAGCGTCACCATGCTGCCCGCCGCCGTCGCG
GCCGTCCCGGACACCTGCCAGGTGTTCGTGGACAGCGGCATCCGCAGCGGCACCGACATC
CTGCGGGCGCTGGCGCTCGGCGCGCACGGTGTGCTGATCGGGCGGCCGATGCTGTGGGGG
CTGGCGGCGGGTGGCGAGACCGGCGCCGCCGGGGTGCTGGCCGTGCTGGACGCCGAGTTG
CGCGCGGCGATGCGGCTGGCCGGTTGCGCCGACGTCGCGGCGGCCCGGCGGCTGACCGCC
ACCACCGGGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000262 FMN-dependent dehydrogenase (Domain)
 [18-357]  4.2e-120 PF01070
PF01070   FMN_dh
IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site (Active_site)
 [258-264]  PS00557
PS00557   FMN_HYDROXY_ACID_DH_1
IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent (Family)
 [1-364]  6.09991940125948e-130 PIRSF000138
PIRSF000138   Al-hdrx_acd_dh
 [3-364]  PS51349
PS51349   FMN_HYDROXY_ACID_DH_2
IPR013785 Aldolase-type TIM barrel (Domain)
 [11-357]  1.29999999999998e-122 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit