close all open/close all

CDS information : Teicp2_00480


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction82,573 / 83,325 / + [in whole cluster]
82,573 / 83,325 / + [in contig]
Location82573..83325 [in whole cluster]
82573..83325 [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)tcp39
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
Related Reference
ACC
Q6ZZG3
NITE
Teicp_00450
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)
ACC
Q9LAS9
PmId
[12055297] Type II thioesterase from Streptomyces coelicolor A3(2). (Microbiology. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MPVPWFSAPRPLAAPRLRLVCFPYAGGNAATYRSWAGLLPPGVELVAALLPGRAERLDEP
PLVDLDVLLSELVAAAGPLLGPVPLILFGHSLGATVAYEFGRALATEHGCVPAALLVSGA
PAPPVRRRRTGRGLSDDDLERILGKRTDLPAGWLTAELKPFVFPALRADLQLLDGYRWRP
GPLPGVPVVAFGGDADPDVSAADLRAWQRCTTGPARTHVLAGDHFFIAHQPFRELLAATV
GEFAASPIAR
selected fasta
>putative type II thioesterase [thioesterase]
ATGCCCGTACCTTGGTTCAGCGCGCCGCGCCCGCTCGCGGCCCCACGGTTGCGGCTGGTC
TGTTTCCCGTACGCCGGGGGCAACGCCGCCACCTACCGCTCCTGGGCCGGACTCCTGCCG
CCCGGGGTGGAGCTGGTCGCCGCGCTGCTGCCCGGCCGCGCCGAGCGCCTCGACGAGCCG
CCCCTGGTGGATCTGGACGTGCTGCTGTCCGAGCTGGTGGCGGCGGCCGGCCCGCTGCTC
GGCCCGGTCCCGCTGATCCTGTTCGGACACAGCCTCGGCGCGACCGTCGCGTACGAGTTC
GGCCGCGCCCTGGCCACCGAGCACGGTTGCGTGCCCGCGGCCCTGCTGGTCTCCGGCGCC
CCGGCGCCCCCGGTGCGCCGGCGCCGCACCGGCCGCGGCCTCTCCGACGACGACCTCGAA
CGGATCCTGGGCAAACGCACCGATCTCCCGGCCGGGTGGCTGACCGCCGAGCTCAAGCCG
TTCGTGTTCCCGGCCCTGCGGGCCGACCTGCAGCTGCTCGACGGCTACCGCTGGCGGCCC
GGCCCGCTTCCCGGCGTGCCGGTGGTCGCCTTCGGCGGGGATGCCGATCCGGACGTGTCC
GCCGCCGATCTGCGGGCGTGGCAGCGGTGCACGACCGGCCCGGCCCGCACCCACGTGCTG
GCCGGCGACCATTTCTTCATCGCGCACCAACCGTTCCGCGAGCTTCTCGCCGCCACGGTG
GGCGAGTTCGCCGCCAGCCCGATCGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [18-229]  7.00000000000005e-37 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit