close all open/close all

CDS information : Teicp2_00500


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction85,781 / 86,293 / + [in whole cluster]
85,781 / 86,293 / + [in contig]
Location85781..86293 [in whole cluster]
85781..86293 [in contig]
TypeCDS
Length513 bp (170 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tei11
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • similar to S. coelicolor hypothetical protein SCG11A.09c
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MDRSTRRIALDDPAARATAEKVAAALAAQLQRALDGSDADAYDEWFAEDIRWGSPFGLTV
TGFRELNTIHRRLMSRPAEMAAAPASRFEVVSVLAPAPGVVVTHLRRQALEADAFSEMAL
YVLVERDGRWWLAAAQNTPIDPGGAEASGAGRRRTGAARPRFVKVIRAIG
selected fasta
>hypothetical protein [hypothetical protein]
ATGGACAGGAGTACGCGACGGATCGCACTGGACGATCCAGCGGCCCGCGCGACCGCCGAG
AAGGTCGCCGCGGCGTTGGCGGCGCAGCTGCAGCGAGCTCTGGACGGCTCGGACGCGGAC
GCGTACGACGAATGGTTCGCCGAGGACATCCGCTGGGGCAGCCCGTTCGGGCTGACCGTG
ACCGGATTCCGGGAGCTGAACACGATCCACCGCCGACTGATGAGCCGGCCGGCGGAGATG
GCGGCGGCGCCGGCCTCACGGTTCGAGGTCGTCTCCGTCCTGGCCCCCGCGCCCGGAGTC
GTGGTGACGCACCTTCGCCGGCAGGCGCTGGAGGCCGACGCCTTCTCCGAGATGGCGCTC
TACGTGCTGGTCGAACGCGACGGCCGGTGGTGGCTGGCCGCCGCGCAGAACACGCCGATC
GACCCGGGCGGCGCCGAGGCGTCCGGCGCCGGCCGGCGGCGTACCGGAGCGGCTAGGCCG
CGTTTCGTAAAGGTCATCAGAGCCATTGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit