close all open/close all

CDS information : Teicp2_00510


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction87,170 / 86,277 / - [in whole cluster]
87,170 / 86,277 / - [in contig]
Locationcomplement(86277..87170) [in whole cluster]
complement(86277..87170) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)putative transposase, IS1650 family
Gene
Gene (GenBank)tei12
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q6ZZG1
NITE
Teicp_00470
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Family/Domain
FD
IPR025161

close this sectionSequence

selected fasta
>putative transposase [putative transposase, IS1650 family]
MPRVAAARRHDLTDVQWAVLEPALPAEPRRGRPPRWTKRQIIDGIRWRVRAGTPWRDVPE
VYAPWQTLYRWFRRWQRDGTWAKILARLQTRADAAGDIEWAVSVDSTISRAHQHAAGARR
DGDLQKEPPGGVFAEPGDHALGRSRGGFTTKTHLACEQGRKTLSTVITAGQRGDSPQFIK
VLERIKVYRVGGGRPRTRPDLVLADKAYTSRGNRGYARRRRIRVCIPSKADQDAYRKAKG
SKGGRPPAFDPVVYRQRHAVECGINQLKQNRAMATRYDKLAVRFEATVTIAVINQWL
selected fasta
>putative transposase [putative transposase, IS1650 family]
GTGCCCAGGGTAGCGGCAGCGAGGCGACACGATCTCACCGACGTTCAGTGGGCGGTGCTG
GAACCTGCGCTGCCTGCGGAGCCACGGCGAGGCCGTCCGCCGCGATGGACGAAACGGCAG
ATCATCGATGGGATCCGGTGGCGGGTCCGGGCGGGAACACCGTGGCGGGACGTGCCCGAG
GTGTACGCACCCTGGCAGACGTTGTATCGCTGGTTCCGGCGCTGGCAGCGCGACGGGACG
TGGGCGAAGATCCTGGCCCGGCTCCAGACCCGGGCCGACGCCGCCGGTGACATCGAGTGG
GCGGTGAGCGTCGATTCCACGATCAGCCGTGCCCATCAGCATGCCGCGGGTGCCCGTCGT
GATGGTGACCTGCAGAAGGAACCGCCGGGTGGGGTGTTCGCCGAACCCGGCGATCATGCT
CTGGGCAGGTCCCGGGGCGGGTTCACCACCAAGACCCATCTGGCCTGTGAGCAGGGTCGT
AAGACGCTGTCGACGGTGATCACCGCTGGTCAGCGGGGTGACAGCCCGCAGTTCATCAAG
GTCCTGGAACGCATCAAGGTCTATCGGGTCGGTGGTGGCCGGCCCCGTACCCGGCCGGAT
CTGGTCCTGGCGGACAAGGCGTACACCAGCCGGGGCAATCGCGGGTACGCCCGCCGCCGC
AGGATCAGGGTGTGCATCCCGAGCAAGGCCGACCAGGACGCCTACCGCAAGGCCAAAGGC
TCCAAGGGCGGGCGTCCTCCGGCGTTCGACCCGGTCGTGTACCGGCAGCGTCACGCCGTG
GAATGCGGCATCAACCAGCTCAAACAGAACCGGGCGATGGCCACCCGGTACGACAAGCTT
GCCGTCCGCTTCGAAGCCACCGTCACCATCGCCGTCATCAACCAATGGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025161 Putative transposase IS4/IS5 family (Family)
 [12-85]  1.1e-26 PF13340
PF13340   DUF4096
SignalP No significant hit
TMHMM No significant hit