close all open/close all
Teicp2_00520 Teicp2_00520   last last

CDS information : Teicp2_00530


close this sectionLocation

Organism
StrainATCC 31121 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction89,052 / 89,507 / + [in whole cluster]
89,052 / 89,507 / + [in contig]
Location89052..89507 [in whole cluster]
89052..89507 [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transcriptional regulator, MerR family
Gene
Gene (GenBank)tei14
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>[putative transcriptional regulator, MerR family]
MRIGELAARTGVSVRALRYYEQQDLLSAERGSSSHRRYPESAVDRVQLIQRLYQAGLTSK
TIVELLPCVVGDRATPAMLERLAAEREQIDQRITDLVRTRDRLDAVISNATDSMLTGASC
RDGDVSGRRPGTKPRRSAGGTVREEHGGGEV
selected fasta
>[putative transcriptional regulator, MerR family]
ATGCGTATCGGCGAGCTGGCCGCCCGCACCGGTGTCAGTGTCCGGGCACTGCGCTACTAC
GAGCAGCAGGATCTGCTCAGCGCCGAGCGCGGTTCGAGCAGCCATCGCCGGTACCCCGAG
AGCGCGGTCGACCGGGTCCAGCTGATCCAGCGGTTGTACCAGGCCGGGCTGACCAGCAAG
ACCATCGTCGAGCTGCTGCCGTGCGTCGTCGGTGACCGCGCCACCCCGGCGATGCTCGAG
CGGCTGGCAGCCGAACGCGAGCAGATCGATCAGCGCATCACCGATCTCGTCCGAACCCGG
GACCGGCTCGACGCCGTGATCAGCAACGCGACCGACAGCATGCTTACCGGCGCCTCCTGC
CGTGACGGTGACGTATCCGGCCGGCGGCCGGGCACGAAGCCGCGGCGATCGGCGGGAGGG
ACCGTGCGGGAGGAACACGGCGGGGGCGAGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000551 Transcription regulator HTH, MerR (Domain)
 [4-26]  PS00552
PS00552   HTH_MERR_1
 [2-13]  1.20000117458134e-10 PR00040 [13-26]  1.20000117458134e-10 PR00040 [36-56]  1.20000117458134e-10 PR00040
PR00040   HTHMERR
 [1-69]  1.39999892049878e-21 SM00422
SM00422   HTH_MERR
 [1-68]  PS50937
PS50937   HTH_MERR_2
IPR009061 DNA binding domain, putative (Domain)
 [1-109]  5.20000089003336e-26 SSF46955
SSF46955   Putativ_DNA_bind
SignalP No significant hit
TMHMM No significant hit
Teicp2_00520 Teicp2_00520   last last