close all open/close all
first first   Teicp_00020 Teicp_00020

CDS information : Teicp_00010


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction1,517 / 552 / - [in whole cluster]
1,517 / 552 / - [in contig]
Locationcomplement(552..1517) [in whole cluster]
complement(552..1517) [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF11
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZK7
NITE
Teicp2_00070
ACC
Q9S166
PmId
[10540289] The A-factor regulatory cascade leading to streptomycin biosynthesis in Streptomyces griseus : identification of a target gene of the A-factor receptor. (Mol Microbiol. , 1999)
ACC
B6V2A5
PmId
[24694298] Identified members of the Streptomyces lividans AdpA regulon involved in differentiation and secondary metabolism. (BMC Microbiol. , 2014)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
MVPRRVALIVDEHSNPFEVGCACEIFGGRRRPQIGYELYELTVVSPTRSVPMRDRLFRVS
APGRLSDLDRADMIIVPNRPDVDVPSRGAVLAAIRRAHARGARLVGLCTGAFTLAEAGVL
DGRRAAVHWQLAPDFHRRFPAVRLEPDVLFVDDGDILTSAGSAAALDLGLHIVRRDHGTE
VANRVGRQLVFAAFRDGGQRQFVERPLPAPATSPLAPVLQWAQERLHLRLSVDDLARHGR
MSTATLHRRFRNEVGSTPLAWLTAQRVALACRLIEQGAAGVDAVARQSGLGTAANLRALL
RKHVGLSPSEYRRRFAADGAR
selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
ATGGTGCCGCGGCGGGTCGCGCTGATAGTCGACGAACATTCCAACCCGTTCGAGGTGGGC
TGTGCCTGCGAGATCTTCGGCGGCCGCCGGCGCCCACAGATCGGCTACGAGCTGTACGAA
CTCACCGTCGTCAGCCCGACCAGATCGGTACCGATGCGGGACCGGCTGTTCCGCGTCAGC
GCGCCCGGGCGGCTGAGCGACCTGGACCGGGCCGACATGATCATCGTGCCGAACCGGCCG
GATGTCGACGTCCCGTCCCGCGGCGCGGTCCTGGCGGCGATCCGGCGGGCCCACGCGCGG
GGCGCCCGCCTGGTCGGCCTCTGCACCGGCGCCTTCACGCTCGCCGAGGCGGGGGTGCTC
GACGGCCGCCGCGCGGCGGTGCACTGGCAGCTGGCTCCGGACTTCCACCGGCGCTTCCCG
GCCGTACGGCTGGAGCCGGACGTGCTGTTCGTCGATGACGGCGACATCCTGACCTCGGCG
GGCAGCGCGGCGGCGCTCGACCTCGGCCTGCACATCGTCCGCCGCGACCACGGCACCGAG
GTGGCCAACCGGGTCGGCCGGCAGCTGGTGTTCGCCGCGTTCCGCGACGGCGGCCAGCGG
CAGTTCGTCGAACGCCCGCTGCCGGCGCCGGCGACGAGCCCGCTCGCGCCGGTCCTGCAG
TGGGCGCAGGAGCGCCTGCACCTGCGGCTGTCGGTCGACGACCTGGCCCGGCACGGCCGG
ATGAGCACCGCCACGCTGCACCGGCGCTTCCGCAACGAGGTGGGCAGCACCCCGCTGGCG
TGGCTGACCGCGCAGCGCGTCGCGCTGGCGTGCCGCCTGATCGAGCAGGGCGCCGCGGGC
GTGGACGCCGTGGCCCGGCAGTCCGGTCTGGGCACCGCCGCCAACCTGCGCGCCCTGCTG
CGTAAGCACGTGGGCCTGAGCCCGTCGGAGTACCGCCGGCGCTTCGCCGCCGACGGCGCG
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [211-262]  4.99999811956429e-08 SSF46689 [265-315]  4.99999811956429e-08 SSF46689
SSF46689   Homeodomain_like
 [219-265]  2.7e-17 G3DSA:1.10.10.60 [266-315]  1.2e-09 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [216-314]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [229-312]  1.39999892049878e-22 SM00342
SM00342   HTH_ARAC
IPR025628 DJ-1 domain, InhA-type (Domain)
 [37-174]  2.3e-31 PF13278
PF13278   DUF4066
SignalP No significant hit
TMHMM No significant hit
first first   Teicp_00020 Teicp_00020